KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102451343Help
Entry
102451343         CDS       T02980                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00010  Glycolysis / Gluconeogenesis
pss00051  Fructose and mannose metabolism
pss00052  Galactose metabolism
pss00500  Starch and sucrose metabolism
pss00520  Amino sugar and nucleotide sugar metabolism
pss00524  Neomycin, kanamycin and gentamicin biosynthesis
pss01100  Metabolic pathways
pss01200  Carbon metabolism
pss04910  Insulin signaling pathway
Module
pss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pss_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102451343 (HK1)
   00051 Fructose and mannose metabolism
    102451343 (HK1)
   00052 Galactose metabolism
    102451343 (HK1)
   00500 Starch and sucrose metabolism
    102451343 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102451343 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102451343 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102451343 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pss04131]
    102451343 (HK1)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102451343 (HK1)
Membrane trafficking [BR:pss04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102451343 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102451343
NCBI-ProteinID: XP_006121588
Ensembl: ENSPSIG00000014935
UniProt: K7G9T9
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRLSDETLLDIMARFKREMQNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMETEIYDTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVTFRSANLVASTLGAILNQLRDNKGVTRLRTTVGVDGSLYKMH
PQYSRRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRTEIEAGLRKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEVMLGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATECEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVEGDQGRMCVNMEWGAFGDNGCLDD
IRTTYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNGTCDDSIIVKMVCGAVSRRAAQVCGAGMAA
VVDKIRENRGVDHLEVTVGVDGTLYKLHPHFSRIMHQTVKDLAPKCNVTFLLSEDGSGKG
AALITAVGCRLRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgcccagcttctggcctattacttcacagaattaaaggatgatcaggtcaaa
aagattgataaatatctgtattccatgcgactctctgatgaaacactgctggatattatg
gctcgcttcaagagagagatgcaaaatggtctttctagagacttcaatccaacagccaca
gtaaaaatgcttcctacatttgtacggtcaattcccgatggctcagagaaaggagatttc
attgcgttggatcttggtggatcttattttcgaattctgcgagtgaaagtttctcatgag
aaaaagcagaccgtacaaatggaaactgagatttatgatacaccagaagatatcatgcac
ggaagtggaacacggctctttgatcatgttgctgaatgcctgggagatttcatggaaaaa
caacaaatcaaagacaagaaattaccagttgggtttacattttctttcccgtgtagacaa
tcgaagttggatgagggtattctgataacttggacaaaacgcttcaaagcaagtggcgtt
gaaggagcagatgtagtaaagctactaaacaaggcaatcaagaaacgtggggactatgat
gcagacatcatggctgttgtaaatgacacagtaggaacaatgatgacctgtgggtttgat
gaccagcgttgtgaagttggcttgattataggcactggcacaaatgcttgctacatggaa
gaaatgaggcacattgatctggtggaaggtgatgaggggaggatgtgcattaacactgag
tggggagcctttggagatgatgggtcactagaagacatcagaactgagtttgacagggag
attgaccgaggatctcttaatcctggaaaacaactgttcgagaagatggttagtggaatg
tacatgggtgagctggtcaggcttatccttgtgaagatggccaaggaggggctactattt
gaagggcgaatcactccagagcttttaaccaaaggaaaatttgaaacgaaacacgtgtct
gccatagaaaaaagcaaagaaggtctgaataaagccaaagaaattttgacacgtcttggg
gtagaaccatcccatgaagactgcattgctgtccagcacgtctgtacaattgttacattc
cgttctgctaatctggtggcaagtactttgggtgcaattctaaatcaactgcgtgataat
aaaggagtaaccaggctgcgtaccacggtgggtgtggatggttccctttacaagatgcat
ccacaatactccaggcgcttgcacaaaacgacaaggcgattagttcctgactcagatgtc
cgatttcttctgtctgagagtggcagtggaaagggtgctgcaatggtcacagcagtagca
tacaggctgtctgagcagcacaggctgatagatgagactctggctgaattcaagcttact
catgagcagctgttgcaggttaaaaaaaggatgcgaacagaaattgaagctgggctgagg
aagaaaactcatgaaacagcaaaagtaaaaatgctgcccacctttgttcgcagcacacca
gatggaacagagaatggagattttctggctctcgatcttggaggaacaaacttcagagtt
ttgcttgtgaagatccgtagtggtaaaaagagaacagttgaaatgcacaataaaatatat
gctattcctatagaagtcatgctgggtactggagaagaactatttgatcacattgttacc
tgtatctcagacttcctggattacatgggaataaaaggcgcacgacttcctcttggcttt
acattttccttcccttgcaagcagaccagtttagatgctggtatcctcctcaactggacc
aaaggctttaaagctacagaatgtgaaggagaggatgtagtgtatttgcttagggaagga
attaaaaggagagaggagtttgacttggacgtggtggcagtggtgaatgatacagttggc
actatgatgacttgtgcatatgaagatccgaattgtgaaataggactcattgtggggact
ggcagcaatgcatgttacatggaggaaatgagaaatatagagatggttgagggagatcaa
ggacgaatgtgtgtgaacatggaatggggtgcatttggagacaatggatgcctggacgac
atcaggaccacttatgacaaagctgttgatgattattcattaaatgctggaaaacaaagg
tatgagaaaatgattagtggaatgtacctgggagaaatcgttcgcaatattttgattgac
ttcactaaaagaggattcctatttagaggtcaaatttcagagacactgaagaccagaggt
atctttgaaaccaagtttctttcacagattgaaagtgacaggttagcattgcttcaggta
cgagcaatcctccagcagctgggtttgaatggtacctgcgatgacagtataattgtaaag
atggtttgtggagcagtatcaaggagagcagctcaagtgtgtggagctggaatggctgct
gtggtagataaaatacgggagaatagaggcgtagaccacctggaagtaacagttggtgta
gatgggactctgtataaactacatccacacttttcaagaatcatgcatcagacagtaaag
gatctcgcaccaaaatgcaatgtgacattccttctttcagaagatggtagcgggaaaggg
gcagctctcattactgctgtgggatgtagacttcgtgatgctgagcaaaactaa

DBGET integrated database retrieval system