KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102451554
Entry
102451554         CDS       T02980                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04020  Calcium signaling pathway
pss04260  Cardiac muscle contraction
pss04261  Adrenergic signaling in cardiomyocytes
pss04270  Vascular smooth muscle contraction
pss04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102451554 (CACNA1C)
   04020 Calcium signaling pathway
    102451554 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102451554 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102451554 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102451554 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102451554 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pss04040]
    102451554 (CACNA1C)
Ion channels [BR:pss04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102451554 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 102451554
NCBI-ProteinID: XP_014435161
LinkDB
Position
Unknown
AA seq 2253 aa
MFQAFVRQSTSAYRPLPNHLPGEPEVKYKGKLVHETQLSCFYIQPGGSNYGSPHTVHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQK
KQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNMQSGGQEEDASPCAPQLAHGRQCPNGTECK
PGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENED
EGMDEEKPRNMSMPTSETESVNTDNVAGTDIEGENCGARLAHRISKSKFSRYWRRWNRFC
RRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLL
KMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRY
WNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFP
QSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYLADAESLTSAQ
KEEEEEKERKKLARTASPEKKKEIEKPAVEEETKEEKIELKSITADGESPPTTKINVDDY
QPNENEEKNPYPTTEAPAEEEEEEPEMPVGPRPRPMSELHLKEKAAPMPDASAFFIFSST
NRFRLHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHYSFRNQILFYFDIVFTVIFTI
EIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGI
QSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACI
GVQLFKGKLYFCSDKSKQTEAECKGYYIYYKDGEVSSPTIQPRQWENSKFDFDNVLTAMM
ALFTVSTFEGWPDLLYSSIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVI
VTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNHYQYKVWYVVNSTYNKGTLK
LKFQTDKEGNAVFSQHRVYLWNSQGVIGTKRASPFQRGLKPYISKQPIPHSASGMLVFQH
YGQSCLFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTD
INRNNNFQTFPQAVLLLFRCATGEGWQEIMLACLSNKRCDPDSEPANSTEGDHSCGSGFA
IFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASE
DDIFRRAGGLFGNHVSYYQSDGRSSFPQTFTTQRPLHINKAGNNQGDTESPSHEKLVDST
FTPSSYSSSGSNANINNANNTALSRFPNPPSYPSTVSTVEGHGTPLSPTIRVQEAPWKLT
SKRTHYYETLGRASSRDSQLAIVCQEEVSQDEPYDENLNEDIEYCSEPSLISTEMLSYQD
DENRQLTPPENNKAESTRASPKKGFLRSSSLGRRASFHLECLKRQKNQDVDVSQKTVLPL
HLVHHQALAVAGLSPLLQRSHSPATFSPRLCATPPAGPCSQGWPQKTIPTLRLDGVESSE
KLNSSFPSIHCSSWYSDSTSCSSPRRARPVSLTVPTQTGGSSRQFHGSAGSLVEAVLISE
GLMQFAQDPKFIEVTTHELADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDPG
QDSAGEEEEEVQSPDCRKSQEELQDSRIYVSSL
NT seq 6762 nt   +upstreamnt  +downstreamnt
atgtttcaagcctttgttcggcaatctacttcagcatatcgcccactaccgaaccatctg
ccaggtgaacctgaagtgaagtataagggcaagttggtgcatgaaactcagcttagctgc
ttctacatccaacctggaggttccaactatgggagtccccacacagttcatgccaacatg
aatgccaatgcagcagcagggcttgccccggagcatatccctactccaggggcagctctg
tcctggcaggctgctatcgatgctgccaggcaggccaaattgatgggtagtgctggcaat
gcaacaatatccacagctagctccacgcagaggaaacgacagcagtatgggaaacagaaa
aaacagggtacaaccacagctacacgtcctccccgggcattgctgtgtttaacgctgaaa
aatcccatccggagggcatgcatcagcatcgttgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaagat
gattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataattttt
acagtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagtgca
attttagaacaagcaaccaaagcagatggggcgaattcaataggagggaaaggtgccgga
ttcgatgttaaagcattgcgggctttccgagtgttacgccccttacgactggtttctgga
gttcctagtctccaggtggttttaaattccattatcaaggctatggttcccttgctgcac
attgccctgctggtgctgtttgtcataattatctatgctatcattggactcgagctattc
atggggaagatgcacaagacctgctacaatatgcaaagtggaggacaagaagaggatgcc
tctccctgtgcccctcaattagcacatggacggcagtgtccgaacggcactgagtgcaaa
cctggatgggaagggcccaagcatggcattaccaatttcgacaactttgcttttgccatg
ttaactgtgtttcagtgcatcactatggagggctggacagatgtactatactgggtcaat
gatgccataggaagggactggccctggatctattttgttacactaatcatcatagggtca
ttttttgtacttaacttggttctcggtgtacttagcggggagttttccaaggaaagagag
aaggcaaaggctcggggtgactttcagaagttgcgggagaaacaacagctggaggaagac
ttgaagggatatttggattggataactcaagcagaagacattgatccagaaaatgaagat
gaaggcatggatgaggagaaaccccgaaacatgagcatgcctacaagtgagactgagtcc
gtgaacacagacaatgtggctggaacagatattgaaggagaaaactgcggtgctaggctg
gcgcatcggatctccaaatctaagtttagccgctactggcgccggtggaacaggttctgc
aggaggaagtgccgagctgctgtcaagtccaatattttctactggctggtgatcttcctt
gtgtttctcaacacccttaccattgcctctgaacactacaaccagccagactggctcact
gaggtccaagacactgcaaataaggtgctgctagctcttttcacggcagagatgctgctg
aagatgtacagcttaggtctccaggcctactttgtgtctctcttcaaccgctttgactgc
tttattgtttgtggaggaatcctggagaccatccttgtggagaccaagatcatgtcacca
ctgggcatctcggtgttgagatgcgtccgactcctgagaatttttaaaatcacaaggtat
tggaactccttgagtaacctagtggcttcactgctgaactcagtccgctccatcgcttcc
ctgttgctgcttctcttcctcttcatcatcatcttctcgctgctgggaatgcagctcttt
gggggcaagtttaacttcgatgagatgcaaaccaggaggagcacattcgataacttcccc
cagtctctcctcactgtgtttcagatcctgactggggaggactggaattcggtgatgtat
gatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttacttc
atcatcctcttcatctgtggaaattatcttgctgatgctgagagtttgacatctgctcag
aaagaagaggaagaggaaaaagaaagaaaaaaactggctaggactgctagtcctgaaaag
aaaaaggagattgagaaaccagctgtggaggaagagacaaaggaggagaaaattgagctg
aaatcgatcactgctgatggggagtccccacctactaccaagatcaacgtggatgattat
cagcccaatgaaaatgaagagaagaatccatatcctactactgaagctccagcagaggaa
gaggaggaggagcctgaaatgcctgtcggccctcggccacgcccaatgtctgaactgcac
ctcaaagaaaaggccgcgcccatgccggatgccagtgcttttttcatcttcagctctacc
aacaggtttcgtctccactgccatcgaatcgttaatgataatattttcaccaacctgatc
ctctttttcatcttgctcagcagcatctccctggcagctgaggaccctgtccgacactac
tcctttaggaaccaaattctcttttattttgatatagtttttactgtcattttcaccatt
gaaattgctctgaagatcctaggcaatgcagactatgtcttcactagtatctttacatta
gaaattattcttaagatgaccgcatacggagccttcctccacaagggctccttctgcagg
aactacttcaacatcctagacttgctggtggtcagcgtttctctcatctcctttgggatc
cagtccagtgctatcaacgtagtgaagatcttacgtgtcctaagagtactcagaccactg
agggccatcaacagagccaagggactaaagcacgtggtccagtgtgtatttgtagccatc
agaaccattggaaacattgtgatcgtcaccactttgctgcaattcatgtttgcctgcatt
ggagttcagttgttcaagggcaaactgtatttctgcagcgacaaatccaagcaaacagaa
gcagaatgcaaggggtattatatttattacaaagatggagaagtcagcagtccgacgatc
cagccccgccagtgggagaacagcaagttcgactttgacaacgtcttgactgccatgatg
gcactcttcactgtttcaacctttgaaggctggccagatctgctgtacagctccattgat
tctcacacggaggatgtgggacccatctataaccacagggtggagatctccattttcttc
attatctatatcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcatt
gtcacgtttcaggaacaaggagagcaggaatacaagaactgtgagctggacaagaaccag
cgccaatgtgttgagtatgccctgaaggcccgccccctgcggaggtatatccctaagaac
cattaccagtacaaagtgtggtatgtggtgaactccacctataacaagggcacattgaaa
ctgaaatttcaaactgacaaagaaggaaatgctgtttttagccaacatagagtttacctg
tggaattcacaaggtgttattggaacaaagagagctagtccttttcaaagggggttgaaa
ccctatatatccaaacagcccattcctcacagcgcttctgggatgcttgtgtttcagcat
tatggtcagagctgtctcttcaaagaagccatgaatatcctcaacatgctcttcaccggt
ctcttcactgtcgagatgattctaaagctcatcgccttcaaacccaagggttactttagt
gatccttggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcattctc
agtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgctct
tcctctatgaatgcagaggaaaattcgcgcatctcaatcacctttttccgactcttccgg
gtgatgcgtctcgtgaagctcctgagccgtggggagggcatccggacgttgctttggacc
ttcatcaagtccttccaggctctcccctatgtggctcttctaatagtgatgttattcttt
atctatgcggtgattggaatgcaggtgtttggtaaaattgctctgaatgacaccacggat
atcaaccgcaacaacaactttcagacgttccctcaagcagtgctgctactcttcaggtgt
gccactggtgaaggctggcaggagatcatgcttgcgtgtctgtcaaataaaaggtgcgac
cctgactcagagccagccaactccactgaaggcgaccattcctgtgggagcggctttgcc
atcttttacttcatcagcttctacatgctctgtgccttcttgatcatcaatctttttgta
gctgttattatggataactttgactacttaacacgggactggtccattctggggccacac
cacctggatgagtttaaaaggatctgggcagagtatgatcctgaagccaagggaagaatc
aaacacctggacgtggtgacgctgctccggcggattcagcctccactgggttttgggaag
ctctgtcctcatcgagtggcttgcaaacgcctcgtctctatgaatatgccactgaacagt
gacgggactgtcatgtttaatgccaccctctttgccttggtcagaacagcactgaggatc
aaaactgaaggtaacctggagcaagccaacgaggagctgcgagcgatcattaagaaaatc
tggaagcgcaccagcatgaagctgctggatcaggttgtgcccccagcaggtgacgatgag
gtaacagtggggaaattttatgccactttcctgatccaagagtatttccggaaattcaag
aaacgtaaggaacagggcctcgtgggcaaaccgtcgcagagaaatgctctctccttgcag
gctgggttgcgcacattgcatgacattgggccggagatccgacgggcgatctcaggagac
ctgacagctgaagaggagctagataaggccatgaaagaagctgtttccgctgcctcagaa
gatgatatcttcaggagggctggtggcctgtttggaaaccatgtcagctactaccaaagc
gatggcaggagctcgttccctcagacattcaccacccagcgccctttgcacatcaataaa
gctggcaacaaccagggagatactgagtccccatcacacgagaagctagtggattccacc
ttcactccaagcagctactcatcttcaggctccaacgccaacatcaacaatgccaacaat
actgccttgtcccgcttccccaacccacccagctacccaagtactgtcagcacagtggag
gggcatggcacacccttgtcaccaaccatacgagtgcaggaggccccttggaaactcact
tccaaaaggacacattactatgaaacattgggacgcgcctcttccagagacagccagctg
gcaatcgtttgccaagaggaagtgtcccaggatgaaccttacgatgagaatttgaatgaa
gacatagagtactgtagcgaaccaagcctgatctctactgaaatgctctcataccaagac
gatgaaaacaggcaactgactccacctgaaaacaacaaagcggagagcaccagggcatct
ccaaagaaagggtttcttcgctcctcgtccctgggtcgaagagcatcttttcatttggag
tgtctgaagagacagaaaaaccaagacgtcgatgtctcacagaagacagttctgccattg
catctggtacaccatcaggcactagcagtggcagggctgagtcccctactccagagaagc
cattccccagcaactttctccccccggttgtgtgccacccctcctgccggaccctgtagc
caaggctggccgcagaaaaccatcccgacgttacggcttgatggagtggagtccagtgag
aaactcaacagtagcttcccatcaatacactgcagctcctggtattctgacagcaccagc
tgcagcagcccacggcgagccaggccggtctccctcaccgtccccacccagactggaggg
agcagcaggcagttccacggcagtgctggcagccttgtcgaagcggtcttgatttcagaa
ggactgatgcagtttgctcaagatccaaagttcattgaagtcacaactcacgagctagca
gatgcctgtgacatgacaatagaagagatggaaaatgcagcagacaacatactcaatggt
aacagcaagcagagccccaatggcaacctcttgccttttgttaactgcagggacccaggg
caggacagtgcaggagaggaagaggaagaggtgcagagcccggattgtagaaaaagtcag
gaagagctccaggacagcaggatttatgtcagcagcctgtag

DBGET integrated database retrieval system