KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452459
Entry
102452459         CDS       T02980                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04012  ErbB signaling pathway
pss04068  FoxO signaling pathway
pss04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102452459 (CDKN1B)
   04068 FoxO signaling pathway
    102452459 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102452459 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102452459
NCBI-ProteinID: XP_006115553
Ensembl: ENSPSIG00000010718
UniProt: K7FV40
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVHREELSRDLMKHRQDMEEACQRKW
NFDFTNHMPLAGRFEWQAVEKGSSPEFYFRPPRPPKVACRSAPHESLDVNGNCPTVIVVG
FQGNSEDAHFVDQKTDVSENHTDLAEQCTGQRKRPATDDSSPQPKRANTTEEEVSEEPPS
ASSVEQTPKKSSPRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgtatttctaatgggagcccgaccctggagcggatggaagcccggcag
tcggagtatccaaagccttccgcttgtaggaacctctttgggccggtgcatcgtgaagag
ttaagcagagacttaatgaaacatcgccaggacatggaagaggcatgtcaaaggaaatgg
aattttgatttcacgaatcacatgcccctggctggcaggttcgagtggcaagcggtggag
aaagggagctcgccggagttctacttcaggcccccccgaccccccaaagtcgcttgcaga
tctgcccctcacgagagtttggatgtaaatggaaactgcccaacggtgattgtagttggt
tttcaggggaactcagaggacgctcactttgtagatcaaaaaactgatgtatctgaaaat
cacacggacttagcagagcagtgcactgggcaaagaaaacgaccagcgacggatgattcc
tctcctcagcctaaaagagccaacacaacagaagaagaggtttcagaagaaccccccagt
gccagttcagtggagcaaacccccaagaaatccagcccaagaagacgtcaaacgtaa

DBGET integrated database retrieval system