KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452549Help
Entry
102452549         CDS       T02980                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00250  Alanine, aspartate and glutamate metabolism
pss00410  beta-Alanine metabolism
pss00430  Taurine and hypotaurine metabolism
pss00650  Butanoate metabolism
pss01100  Metabolic pathways
Module
pss_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102452549 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102452549 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102452549 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102452549 (GAD1)
Enzymes [BR:pss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102452549 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 102452549
NCBI-ProteinID: XP_006118264
Ensembl: ENSPSIG00000002335
UniProt: K7F2V3
LinkDB All DBs
Position
Un
AA seq 590 aa AA seqDB search
MASSAPSSSNTAQDPNPTNLRPTTYDTWCDVAHGCTRKIGLKICGFLQRNNSLEDRGRIV
SSLKERQSSKNLLACENSEREARFRRAETDFSNLFARDLLPAKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDVIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNLYSIMAARYKYFPEVKTKGMAAVPKLILFTSEHSHYSIKKAGAALGFG
TENVILIKCNERGKIIPADLEAKILEAKQKGHVPLYVNATAGTTVYGAFDPIDEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILIREKGIL
QGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELSEYFYTKIKNREEFEMVFDGEPEHTNVCFWYLPQSLRGIPDSEERREKLRKVAPKIKA
LMMESGTTMVGYQPQGDKANFFRMVVSNPAATKSDIDFLIEEIERLGQDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctgctccatcctcctccaacaccgctcaggatcccaacccaactaattta
cgacccacaacttacgacacctggtgtgatgtggctcatggatgtaccagaaaaattggt
ctcaaaatatgtgggttcttgcaaagaaacaatagcctggaagatagaggtcggattgtg
agctccctgaaggaaaggcaatcttccaagaacctgctggcttgtgagaacagcgagagg
gaagccaggttcaggcgggccgagacagacttctccaatttatttgctagagatttgctg
cctgccaagaatggcgaggagcagaccatgcagttcctgctggaggtggtggacattctc
ctcaactacgtgaggaagacgttcgacaggtccaccaaggtcctggacttccatcacccg
caccagctgctggaagggatggagggtttcaacctggagctctcggacaaccccgagtcc
ctggagcagatcctggtggattgcagggacacgctgaagtacggagtcaggacaggtcat
cctcgttttttcaaccagctctccactggactggatgttattggcttggctggtgaatgg
ctgacgtcaactgcaaatactaacatgtttacgtacgaaattgcacctgtttttgtcctg
atggaacaaataacacttcgaaagatgagagagattattggatggtcaaataaagatggt
gatggaatattctcacctggcggggctatatccaatttgtacagcataatggctgctcgc
tacaaatatttccctgaagtcaaaactaaaggcatggctgcagttccaaaactgattctc
ttcacctcagaacatagtcactactcaataaagaaagctggggctgcacttgggtttgga
acagaaaatgtgattttgataaaatgcaatgaaagagggaaaataataccagctgatttg
gaagccaaaattctggaagctaagcaaaagggacatgttccactttatgtaaatgcaaca
gcaggcacaacagtatatggagcctttgatccaatagacgaaattgcagacatatgtgaa
aaatataacctctggctccatgtagatgctgcttggggaggaggacttctaatgtccagg
aagcatcgtcataaactgaatggaatagaaagagccaactcagtcacatggaatccacac
aagatgatgggagttttgttacaatgttcggccattctgattcgggaaaagggtatactt
caaggttgcaatcagatgtgtgctggatatctgttccagcaagacaagcaatatgatata
tcctatgacactggcgataaagcaatacagtgtggacgtcatgtggacattttcaaattc
tggttgatgtggaaagctaagggtacagtaggatttgaaaatcagatcaacaaatgtctg
gaattgtcagagtacttctatactaaaattaaaaacagagaagaatttgagatggttttt
gatggtgagcctgaacacacaaatgtatgcttctggtatcttcctcagagtctcagggga
ataccagactctgaggagagaagagaaaaactacgtaaggtggcaccgaagatcaaagcg
ctgatgatggagtcaggtaccacaatggttggataccagccgcagggagataaagccaac
ttcttccgaatggttgtctcaaacccggcagcaactaagtctgacattgacttcctcatt
gaagaaatagaaagattggggcaggatctgtaa

DBGET integrated database retrieval system