KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452758
Entry
102452758         CDS       T02980                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102452758 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102452758 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pss04052]
    102452758 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pss00536]
    102452758 (FGF1)
Cytokines and growth factors [BR:pss04052]
 Growth factors
  Growth factors (RTK binding)
   102452758 (FGF1)
Glycosaminoglycan binding proteins [BR:pss00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102452758 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102452758
NCBI-ProteinID: XP_006128601
Ensembl: ENSPSIG00000014555
UniProt: K7G7V2
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPLGNYKNPKLLYCSNGGYFLRIHPDGKVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTESGQFLAMDANGLLYGSLSPSEECLFLERMEENHYNTYISKKHADK
NWFVGLKKNGSCKLGPRTHYGQKAVLFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaataacaacgttcaccgccctgaccgaaaaattcaaccttcccctg
gggaattacaagaatcccaaactcttatattgcagcaatggaggctacttcttgaggata
catccagatggcaaagtagatgggacaagggaccgaagtgaccaacacattcagctgcag
ctaagtgcggaaagcgtgggtgaggtatatataaagagcactgagtctggacagtttttg
gctatggacgccaatggacttttatatggatcactgtcaccgagtgaggaatgcttattc
ttggaaagaatggaagaaaatcattataacacctacatctccaagaagcatgcagacaag
aactggttcgttggcttaaagaagaatggaagctgcaaactgggaccgcggacgcactac
ggccaaaaggccgtccttttccttccactgccagtgtcagctgattaa

DBGET integrated database retrieval system