KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452896Help
Entry
102452896         CDS       T02980                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00052  Galactose metabolism
pss00500  Starch and sucrose metabolism
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102452896 (SI)
   00500 Starch and sucrose metabolism
    102452896 (SI)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102452896 (SI)
    3.2.1.20  alpha-glucosidase
     102452896 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102452896
NCBI-ProteinID: XP_014429279
LinkDB All DBs
Position
Unknown
AA seq 2710 aa AA seqDB search
MGRKKFSGLEISLIVLFCLVVIVACILVALLATGHPGLQDFSPDCPSLSVSEKIDCIPDQ
VATKSICTLRGCCWSPQNETNIPWCFFSKSHGYKVEGNVKSTGTGLEAKLTRLPSPSLFG
NDINTVLFTGEYQTANRFRFKITDPNKQRFEVPHEHVKAFKGSAATNLKYSVHVNQNPFG
IIVVRTSNSKTLFDTSIGPLQYADQFLQLSIKLPSSNIYGIGEHVHTQYRHDVNWRTWPI
FTRDAFPNGGTHNLYGAHTFFLCLEDNSGASFGVFLMNSNAMEFALQPTPAVTYRTTGGI
LDFYIFLGDTPEQVVQEYVKLIGMPAMPSYWSLGFQLSRWNYGTLDELKAVVQRNREIGI
PYEIQYTDIDYMEEKKDFTYDQVKFKDLPNFAVDLHNHGQKYIIILDPAIAITPLLNNTP
YLSYDRGESKKVWINEPDGKTQLIGEVWPGLTVFPDYTNPECTNWWVEECKIFHDKVKYD
GIWIDMNEISSFIKGSTRGCQQNNWNYPPFTPKGILDGVMYSKTLCMDAVQFWGKHYDVH
NLYGYSMTLSTEKAIQTVFPGKRSFTISRSTFAGSGKYTGHWLGDNAATWNDLRWAIPGM
LEFNLFGIPYIGADICGFFDNVSEELCRRWMQVGAFYPFCRNHNAENYAPQDPAVFGADS
LLVRSSRNYLTIRYTLLPYLYTLFYNAHAQGGTVVRPLLHEFYSDEATWAIDRQFLWGPG
LLITPVLDPGVEKVIAYIPDAVWYDYETGGRVVWRKQQAEIYLPADKLGLHLRGGYIFPT
QQPANTTLYSRKNPMGLIIALDENGQAAGDLFWDDGESSGTVENKNYIHYNFSVSNNSLK
MSVLHMNYSDPNNLVFEEIKILGLPLKPTLLTVTLNDIVQNSLHNISYDPSNKVTHVTGL
QLELGKAYVLKWNQVLSNTDKFDCHPSPNAAEANCVAMGCVWEPVSTDRVPSCYYPSDYG
YSVSQITYTSSGLSVNLNRNVNYINRAQTSTTPINTLRLDVQYHDNNMLQFKIYDYSNKR
YEVPVPLNIPSSPTSTYENRLYEVTIQNNPFGIQIRRKSTGTIIWDSQVPGFIFTDMFIQ
ISTRLPSQYVYGFGENEHTMFRRDMNWHTWGMFAKDQPPGYKLNSYGVHPFYMGLENDGN
AHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTALIGRPVMPPY
WALGFQLCRYGYKNDIEISDLYEEMKAARIPYDVQYTDIDYMERQLDFTLSPNFTGLPAL
VDRMKMEGMKFIIILDPAISGNETNYPAYTRGVQNDVFIKWPNSTEIVWGKVWPDLPNVV
VNESLDWDTQVKLYRAYAAFPDFFRNTTAQWWQREIREYHTNPNQPEKSVKFDGLWIDMN
EPSSFVHGAVEGCKNQELNNPPYMPSLESRSLGLSHKTLCMESQQFLPDGTPVRHYDVHN
LYGWSHTKPTYDALQNTTKERGIVITRSTYPSSGKWAGHWLGDNTAAWDQLYKSIIGMME
FSLFGISYTGADICGFFNDADYYMCARWMQLGAFYPFSRNHNGAGAKRQDPVAFDEKFEN
ISRDVLNTRYTLLPYLYTLMYQAHVHGSTVVRPLLHEFVEDQTTWDIYRQFLWGPALLIS
PVLENATSVLAYIPNARWYDYYTDEYIKFRREFRNLSTPLEHINLHIRGGYIIPWQDPAN
NTFYSRQNSMGLTVALDDNGFAQGQLYWDDGSSIDAYEKAAYLLETFNASQNVLDIKVVH
NGYTDPNNLKFDEIKILGILGHPLAVIIKQNGVTVPSLHNVNYNAVKQLLHITRLQLELG
KPYSVEWSMSEDNEKFNCYPESGASPENCTARGCIWQVVSNSLVPSCYYPSNYGYSVSNL
QNTALGLTADLSRDPSIPDRYGDRSPSINTLRLEVKYHDNYMLQFKIYDANNKRYEVPVP
LFVPNPSTSTETGRLYEVTIKNNPFGIQIQRRSTGTVIWDSQVPGFTFSDMFIQISTRLP
SQYIYGFGETEHTTFRRDMNWNTWGMFSKDQSPGYKLNSYGVHPFYMGLENDGNAHGVFL
FNSNGMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTALIGRPVMPPYWALGFQ
LCRYGYKNDTEISDLYEEMKAARIPYDVQFTDIDYMDRKLDFTLSPNFSGLPALINRMKD
EGMRFIIILDPPISGNETNDYPAFTRGVQNDVFIKRPSSNEIVWAKVWPDYPNVTVNESS
DLDTQLKLYRAYAAFPDFFRNSTAQWWQKEIVEFHSNPVDPQKSVKFDGLWTDMNEPASF
INGAVDGCRDPLLNNPPYMPSLAEKEKGLTLVTLCMESQQFLPDGTPVRHYDVHSLYGWS
QAPPTYYAIRNATGERGIVITRSTYPSSGRWAGHWLGDNYARWDQLEKSIIGIMEFGLFG
ITYIGADICGFFNDTTYEMCARWMQLGSFYTFSRNHNVIGTMRQDPASFDERFQNISRDV
LNTRYTLLPYLYTIMHETHVYGGTVTRPLLHEFVEEKATWDIYKQFLWGPALLISPVLEE
GATTVNAYIPNARWYDYYTGKELEKRGQFQILQAPLEHINLHIRGGYIIPWQEPGIHTNQ
SRQNFMGLTVALDVNGVSQGQLFWDDGKSIDTYENGNYFLARFAANQNTVNITVAHNNFL
TNTNPLKFGYMNIWGIGSQQVTNVTVIYDGQTHMITNFSTDQGNQVLQIQFTDKIFSMEK
FTQLKWTTSN
NT seq 8133 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggaagaagttcagtggattagaaatctccctgattgtcctattctgtttggtg
gtgattgtagcctgcattctggttgcacttttagcaacaggacatcctggactccaagac
ttttctccagactgtccatccttaagcgtatcagagaaaattgactgtattccagatcaa
gtagcaacaaagagcatatgtacactgcgtggctgttgctggagtccacaaaatgaaaca
aacataccctggtgcttcttctccaaaagtcatgggtataaagtagagggaaatgtgaag
agcacaggtacaggtcttgaagcgaagttaacaaggttgccttcaccttccctatttgga
aatgatattaatactgtcctcttcacgggagaatatcagacagcaaatcgcttccggttc
aagataactgatcctaataaacaaagatttgaagttcctcatgagcatgtaaaagctttt
aaaggatctgcagccaccaatttaaagtacagtgtccatgtcaatcagaacccttttggt
atcatcgtggtgagaacaagcaatagcaaaacactgtttgatactagcataggaccactt
cagtatgctgaccagtttttacagctctcaatcaaactgcccagcagcaacatttatgga
attggagaacacgtccacacacaataccggcatgatgttaactggagaacttggcccata
tttaccagggatgctttccccaatggaggcacacataacttatatggagctcacacattc
ttcttatgcttggaagataacagtggagcctcttttggtgtgttcttgatgaatagtaat
gccatggaatttgctctccagcctaccccagcagtaacttacagaacaactggtggaatt
ctagatttttatatcttcttaggagacactccagagcaagttgttcaagagtatgtaaag
ctaataggaatgcctgcaatgccttcatactggagtcttggattccaacttagtcgctgg
aattatggcactctcgatgagttaaaagctgtggtacaaagaaacagagaaattgggata
ccttatgaaattcagtacactgatattgactatatggaggagaagaaagactttacttat
gaccaagtgaagtttaaggaccttcctaactttgctgtggacctgcataaccatggacaa
aaatacattattatactggaccctgccattgccatcactcccctgcttaataatactcca
tatctttcctatgacagaggagagagcaagaaagtgtggataaatgaaccagatggaaaa
acacagctcattggagaggtgtggccaggactgactgtgttccctgactacaccaaccca
gaatgtaccaactggtgggtagaagaatgtaagatctttcatgataaagtgaagtatgat
ggcatttggatagacatgaatgaaatatccagctttataaaaggttcaacacgcggctgt
cagcaaaacaactggaactatcctccattcactccgaaaggtattctcgatggagtcatg
tattcaaagacactttgcatggatgcagtgcaattctggggaaagcactatgatgttcac
aatctatacggatattccatgaccctatcaactgagaaagctatacagaccgttttccct
ggaaagagaagcttcactatttctaggtctacttttgctggatcaggaaaatacacagga
cattggctaggagacaatgctgctacatggaatgatctgagatgggcaataccaggaatg
ctggaatttaacctcttcgggataccttatattggtgcagatatttgtggtttttttgat
aatgtctcagaagaactttgcagacgatggatgcaagttggagcattttatccattttgc
agaaatcacaatgctgaaaactatgcgcctcaggatcctgctgtatttggggcagattct
cttttggtgagatcatcaaggaactacttgacgattcgatacactttactgccttacctt
tatacccttttttacaatgctcatgcacaaggaggcacagtagtgagaccacttcttcat
gagttttattcagatgaagccacatgggctattgatcgacaattcttgtggggccctgga
ctgcttatcactcctgtgctggacccaggtgtggaaaaagtgatagcatatatccctgat
gcagtatggtatgactatgaaacaggtggaagagtagtatggcgaaaacaacaagcagag
atatatctcccagcagacaaactaggacttcatctgagaggaggctacatttttcctact
cagcaaccagctaatacaacattgtacagccgcaagaatccaatgggactcataattgca
ttagatgagaatggtcaagcagctggagatttattctgggatgatggagaatcttcaggt
acagtggaaaataaaaactacattcattacaatttttcagtttccaacaatagtttaaaa
atgagtgttttgcacatgaattacagtgatccaaacaacttagtatttgaggaaatcaaa
atccttggtttgccacttaaacctacacttcttactgtgactctaaatgatatagtgcag
aattctcttcataatatcagctatgatccttcaaataaggttacccatgtaactggactt
caacttgaactaggaaaagcatatgtgttgaaatggaatcaagtgctcagtaacactgat
aaatttgattgtcatcctagtcctaatgcagcagaagcaaattgtgtagccatgggctgt
gtctgggagcctgtctccactgaccgtgttccttcctgttactatccttccgactatggt
tattctgtcagtcaaattacatacacttcatcaggtttatcagtgaacctcaacagaaat
gttaattacattaaccgagctcagacttctactacccctataaatacacttcgcttggat
gtgcaatatcatgacaataatatgcttcaatttaagatttatgattacagcaataaaaga
tatgaggttccagtaccactaaatatccctagcagtcctacaagtacatatgagaatcga
ctctatgaagtaacaattcagaataatccattcggcatccagattcgacgcaaaagcaca
gggacaattatctgggattctcaggtccctggcttcatctttaccgacatgttcattcaa
atttctactcgcctgccatcacagtatgtctacggatttggtgaaaatgaacacactatg
tttcggcgtgatatgaactggcacacttggggaatgttcgccaaagaccagccccctggt
tacaaactgaattcttatggtgtacatcctttttacatgggcttagaaaatgatggaaat
gctcacggagtcctcttgcttaatagcaatgcaatggatgtcacattccagccaactcct
gccctgacatatcgcactatcggaggaattctggatttttacatggtgttgggcccaaca
ccagagcttgttgttcaggaatacactgcactaattggtcgaccagttatgccaccatat
tgggctttgggatttcagttatgccgttatggatacaaaaatgacatagaaatctctgac
ctgtatgaagaaatgaaggcagctcggataccttatgatgtgcaatacactgatattgat
tacatggaacgacaattagactttaccctcagcccaaacttcactggactaccagctctg
gttgacaggatgaaaatggaaggaatgaaattcatcattatcctggatccagccatttca
ggcaatgaaaccaattatccagcctatacaagaggtgtccagaatgatgtctttattaaa
tggcccaatagcactgaaattgtatggggaaaggtttggccagatcttcccaatgtagtt
gttaatgaatcactagattgggatactcaagtaaagctatacagagcttatgcagctttc
ccagatttcttccgcaacaccacagctcagtggtggcaaagagaaataagagaataccac
actaatccaaaccaaccagagaaaagtgtgaagtttgatggtctgtggattgacatgaat
gaaccttcaagctttgttcatggagcagttgaaggctgtaaaaaccaggagctaaacaat
cctccctatatgcctagtttggaatcacggtcacttgggttgagtcacaaaactttatgc
atggaaagtcagcagttcctaccagatggaacccctgttagacattatgatgtgcacaat
ctatatggatggtcacatacaaaacccacctatgatgctctacagaacactactaaggaa
cgtggaattgttatcactcgttcaacatatccctctagtggcaaatgggctggacactgg
cttggcgataacactgcagcttgggatcagctttataaatctataattggtatgatggaa
tttagcctctttggaatatcctatactggagcagatatttgtggcttcttcaatgatgca
gattattatatgtgtgcccgttggatgcagctgggagcattttacccattttccagaaat
cataatggtgcaggtgcaaagaggcaagatcctgttgcctttgacgaaaaatttgaaaat
atttccagagatgtactcaatacaagatacacactgttaccctatctctacaccttaatg
tatcaagcccatgttcatggtagcactgtagtgcgtcctctcctccatgagtttgtggaa
gaccaaacaacatgggatatatatagacaatttctgtggggacctgcgctgctcattagc
ccggttctggagaatgctacttcagtgttggcttatatacccaatgcacgctggtatgat
tattacactgatgagtatattaaattcaggagagagttccgcaatctatccactcctctt
gagcatatcaaccttcatattcgtggaggctacatcatcccatggcaggaccctgctaat
aatacattttacagccgacaaaactctatgggacttactgttgctttagatgataatggg
ttcgctcaaggtcagctatactgggatgatgggagcagcattgatgcatatgaaaaggct
gcttatctgttagaaacgtttaatgcaagtcagaatgttttagatattaaggttgtgcac
aatggatatactgacccaaacaatttaaaatttgatgaaattaagatcttaggaattctt
ggacatcctttagctgttataatcaaacaaaatggtgtgacagttccatctctccataat
gtcaactataatgctgtaaaacagctcctgcatattactaggcttcaacttgaactgggg
aaaccctactcagtggaatggtcaatgtctgaagacaatgaaaaatttaactgttatcct
gagtcaggtgcatcaccagaaaattgtacagctcgtggctgtatctggcaggttgtctct
aactcacttgtgccatcgtgttactacccaagtaattatggctattctgtcagcaacctt
caaaatacggctttgggtcttacagctgacctctccagagatccaagtatccctgaccgc
tatggggaccgttctccctctatcaacacacttcgcttagaagtgaaataccatgacaac
tacatgttgcagttcaagatttatgatgccaacaataaaagatatgaagttccagtacca
ctatttgtccccaatccttccacaagtacagaaacaggtcgactctatgaagtgacaatt
aagaacaatccatttggtattcagattcagcgtagaagcactggaacagttatttgggat
tctcaggtacctggcttcacctttagtgacatgttcattcagatttctacccgccttcca
tcacagtatatctatggatttggtgaaactgaacatactacatttcggcgtgatatgaac
tggaacacctggggaatgttttccaaagaccagtcccctggttacaagctgaattcctat
ggagtccaccccttttacatgggcctggaaaatgatggaaatgctcatggggtcttcttg
tttaacagtaatggaatggatgtcacattccagccaactcctgctctgacatatcgcact
atcggaggaattctggacttttacatggtgctgggtccaacgccagagcttgttgttcag
gaatacactgcactaattggtcgaccagttatgccaccatactgggctttgggattccag
ttatgccgttatggatacaaaaatgacaccgaaatctctgacctgtatgaagaaatgaag
gcagctcggataccttatgatgtgcaatttacagacattgattacatggaccggaagtta
gactttactctaagcccaaacttttcaggacttcctgctctgattaatcgtatgaaagat
gaaggaatgagattcatcattattctggatccacccatatcgggcaatgaaacaaatgat
tatccagcatttacaagaggtgtgcagaatgatgtcttcatcaaacggcctagcagcaat
gagattgtctgggcaaaggtttggccagattatcctaatgtcacagttaacgagtcttca
gatttagatacacagctcaagttgtacagagcttatgcagctttcccagatttcttccgt
aattctacagcacagtggtggcaaaaagaaatagtggagttccactctaatccagttgat
ccacagaagagtgtgaaatttgatggcttatggactgacatgaatgaaccagcaagcttt
attaatggagcagttgatggctgcagagatccacttctaaacaaccccccttatatgcca
tctttggcagaaaaggaaaaagggctgactctcgtgaccctgtgcatggaaagtcaacag
ttcctgccagatgggacccccgtcaggcactatgatgtacatagtctgtatggatggtca
caggcaccacctacctactatgccatccgcaatgccacaggggaacgtggaattgttatc
acccgttcaacatatccctctagtggacgatgggcaggtcactggctgggtgataactat
gcaagatgggaccagcttgaaaaatctatcattggtataatggagtttggcctctttgga
attacctatattggagcagatatctgtggcttcttcaatgatacaacatatgaaatgtgc
gcccgctggatgcagcttggatcattttacaccttttctagaaatcataatgtgatcgga
actatgaggcaagaccctgcttcatttgatgaaagatttcaaaatatttcaagggatgta
ctcaatacaagatacacactgttaccttatctctacactataatgcatgaaacccatgtt
tatggtggcactgtaacacgtcctttgcttcatgagtttgtggaagagaaagcaacatgg
gatatatacaaacagtttttatggggtccagcattgctgattagccctgtattggaagaa
ggagctacaacagtgaatgcttatatacccaatgcacgctggtatgattattacacggga
aaagaacttgaaaaaaggggacaattccagattttgcaggcacctcttgagcacatcaat
cttcatatccggggtggttacattatcccctggcaagaacctggtattcataccaatcaa
agccgacagaattttatggggcttactgtggctttggatgtcaatggggtttcacaagga
cagcttttctgggatgatggaaaaagcattgatacatatgaaaatggtaattatttctta
gcaagatttgcagcaaaccagaatactgttaatatcactgtggcacacaacaacttccta
actaacaccaatccattgaaatttggctatatgaacatctggggaataggaagccaacag
gttacaaatgttactgtcatttatgatggacaaactcacatgattactaacttcagcact
gaccaaggaaatcaggtattacaaattcaatttactgacaaaatattcagcatggaaaaa
ttcactcaactcaaatggacaacaagcaattaa

DBGET integrated database retrieval system