KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102453637
Entry
102453637         CDS       T02980                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04012  ErbB signaling pathway
pss04068  FoxO signaling pathway
pss04110  Cell cycle
pss04115  p53 signaling pathway
pss04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102453637
   04068 FoxO signaling pathway
    102453637
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102453637
   04115 p53 signaling pathway
    102453637
   04218 Cellular senescence
    102453637
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102453637
NCBI-ProteinID: XP_025036704
LinkDB
Position
Unknown
AA seq 240 aa
MHASELLPQVTFFLSLTVGTTVWQTLCTYLEIYLERYKDGALLLFLCIDGKQPSPLPTLF
QKGEQKIEGGGESLLGTLVGERWIGEQTEWRPAKSTRVRRNLFGPVDHEQLQQDFQHMLH
SSMEGAQQKWNFDFLRDMPAKGLLQWEELQNHDVPVFYHSCVVGEARKPLKPLNQGKVKE
VKVHHFATVTLTENPKVAKKTLSKKSQAGKKRRQTSLTDYYSAKKQVKTNSQAVAKNLTF
NT seq 723 nt   +upstreamnt  +downstreamnt
atgcatgcttctgagctgcttccacaagtcacgttcttcctctccctcacagtagggact
actgtgtggcaaaccctctgcacctaccttgagatttaccttgagagatacaaagatggt
gctttgcttttatttttatgtattgatggaaaacagccttcccctctccccactttattc
cagaagggagaacaaaaaattgaaggaggaggggaatcgttgcttggtacgcttgtcgga
gagcggtggattggagagcagacagaatggaggccagcaaagtcaacccgtgtacgaagg
aacctcttcggccccgtggaccatgagcagctgcagcaggacttccagcacatgctgcac
agcagcatggagggagcccagcagaagtggaactttgacttcctacgagacatgccagct
aaggggctcctgcagtgggaagaactacagaaccacgatgttccagtcttttaccacagt
tgtgtggtgggtgaggctcgcaagcctttgaagcccttgaaccagggcaaagtcaaagag
gtcaaggtccaccattttgccacagtgacactgaccgagaaccccaaagttgccaagaaa
acgttgagcaagaagagtcaagcagggaagaaacgaagacagacatccttgacagattac
tactcagctaagaagcaagtcaaaactaacagtcaagctgttgcgaagaatttgactttc
tga

DBGET integrated database retrieval system