KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102453934Help
Entry
102453934         CDS       T02980                                 

Gene name
USF3, KIAA2018
Definition
(RefSeq) upstream transcription factor family member 3
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 102453934
NCBI-ProteinID: XP_014433954
LinkDB All DBs
Position
Un
AA seq 2236 aa AA seqDB search
MPEMTENETPMKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITEMKRQNDELLLNGGNNEQAEEIKKLRKQLDELQKENGRYIELLKANDICLYDD
PTIHWKGNLKSAKVSVVIPSDQVQKNIIVYSNGSQPGGNNQGASVQGITFNVGHNLQKQT
ANVVPVQRTCNLVTPVTISGVYPTENKPWSQTTVFPFASNXXXPLASNQPVPAEDMLELS
TSENEQGMLTSATASSQNASQSQTEQELQCSSSSTPQNEQSVSKIKSGQECTKLMKKPTM
HGISISSNTTIEASQVQQVNVTSSSLQESRSDFQESVVVSATDTTCTPSVRFSIVDSFPS
VNSLKSTDLSSAGVPVTSAVEAVKAVTAISTLPASPLDNCWSFSGSSGVGTSDLKNVSSL
TRIPSAGITQTTWTTLQLAGNTVQPLPQTPSSVMTALLNEPVNGAGTIPSTHNRHLAPSI
GLNTSVPGDGQAVEQVVVTLPSCPSVPVQPLMTQPQVKTGNVFPLNSAMQVIQMAQTIGS
AVTAVPANQNVIILQPPNTTPCPPVVRAEVPSQPVSQQIVIIQAANQNSLPLLSAQTPGS
LRVPVNGASPIVSSSSSVQNASVPQTFGGKHLVHILPRPPPLPSSSATQTFSVTMSNQQH
PQTISLNGQLFALQPVMSSSGASNQAPMQIIQPTTSEDPNTNVALNTFGALANLNQSISQ
MAGQSCLQLSLSQPANPTTAPSSQIAPINCVSLPTSAASSIATESSTLLSSASDSINTSP
KKSSASLPSNMKSKRTNKKPSTKKHLAANSKTSCPMNPCTDAGKLDCTNVEVTAEHSNSE
GLLENMPVVSEALAVSQANSMAAPTDVNVSDCQSKETLSSEQMVSLPELSSAEVPSSSPL
ESVMSEQFVLVPSSSKDSTALLQNNPLSDSVVPKSPRSCVTTSIPMSSATDAHVTVSQVS
GASAPQNSVTTGHASEAESISETCSVGQESSIEMQTTDLLEGQGLTKMLSDLTKERTAVL
KPSFSLQMEHSDFPSENSKSVKSNVDLPEKQELLLMNTEGDTLTQHHSCIPDQEVVSGSL
VGSRQADSPLSTSSGSSRGFSVASMLPDTTREDVTSSTSTNTCNSCTFSEQTDIVALAAR
AIFDQENLEKSGGEMQINLRDGASKSAEVAPSESEQQPFKPQAAKANLGQLEAAPNKFHA
QDPVQTNIDRAVENSDCSVGVETSNTVQISTSQSPNVTSLSVNNLIHQSRIIHPLVSCSG
LSQPSEPAAVPATVSLSISSSSYVNQSPGSAMMAEYAQDQLSAIRANTMQPPQMQEPHLK
QQNHESRKDSAKRAVQEDLLLSTAKRQKQCQTTPIRLEGMALMNRTPDAIAEQTQMLVSQ
IPPNSSNSVVSVSNQGHTDGLNRLFPSNNNFVTSALRQTEVQCSSQPSISEQQGQHLQSL
QHVSSVQGISHLHSNHPYLKQHQAGQLRERHHLYQLQHHVPHAESSVHSQSHGVHQQRAM
QQEVQMQKKRSLVQGTQASQLSLQQKHHGNDQTRQKSGQPHPHHQQIQQQMQQHFGASQP
EKNCENPSTSRNHHNHPQSHLNQDIMHHQQQDVGNRQQGSGVSSEHVSGHNQMQRLLTSR
GLEQQMVSQPSIVTRPSDMTCAPHRQERNRVSSYSAEALIGKTPSNSEQRIGISLQGTRA
PDQLEMRSYLDVSRNKGLVIHNMQNRISVDHVVGSDVQRLSDCQTFKPNGASQQPTGNFD
VQASRNSEIGNTVSSLRGMQSQAFRISHNTGPPIERQKRLSYQPVQGIPTGNALPPRDNE
NTCHQSFMQSLLAPHLGDQVSGSQRSLSEHQRNTQCSVSSTIEYNCPPSRENVHIRRDSD
GQNRESCDMSMGTINTRNSSLNIPFSSSSSSGDIQGRNTSPNISAQKSNPMRMTDSHATK
SHMNTPVSSNMHGVVRPALPHPAISHGNAEQGQPSVRQPNSSVTQRSRHPLQDNGGSKIR
QPERNRSGNQRHGNVFDPSLPHLPLSTGGSMILGRQQSAIEKRGSIVRFMSDGPQVSNDN
AAADQHALSQNFGFPFIPEGSMNPPINANTSFIPPVTQPSATRTPALIPVDPQNTLPSFY
PPYSPAHPTLSNDISIPYFPNQMFPNPSTEKPTSGGLNNRFGSILSPPRPVGFAQPSFPL
LPDMPPMHMTNTSHLSNFNLTSLFPEIATALPPDGSAMSPLLSIANTSVSDSSKQSSNRP
AHNISHILGHDCSSAV
NT seq 6711 nt NT seq  +upstreamnt  +downstreamnt
atgccagagatgacagagaatgagactcctatgaagaagcagcaccgaaagaaaaaccgg
gagacacacaatgcagtggagagacatcgaaagaagaagatcaatgctgggataaaccga
attggagagctcattccatgttctccagcacttaagcagagcaagaacatgatcctggat
caggcctttaaatatataacagaaatgaaaaggcagaatgatgaactcctgttgaatgga
gggaacaacgaacaagctgaagagataaaaaagctccggaaacagttggatgaactccag
aaggaaaatgggcgatacatagaattattgaaagcaaatgacatttgcctgtacgatgat
cccacaattcactggaaagggaatctcaaaagtgcaaaggtctctgttgttattcctagt
gatcaggttcaaaagaacatcattgtctattcaaatgggagtcagcctggtggaaataac
caaggggcatctgtccagggaattacttttaatgttggtcataacttacagaagcaaacc
gccaatgttgtaccagttcagagaacttgcaacctagtgactcctgtgaccatttctggt
gtttaccccacagaaaacaagccatggtctcagaccacagtttttccatttgcatccaat
nnnnnnnnnccattggcatccaatcagccagttccagctgaggatatgcttgagctttcc
acctcggagaatgagcagggcatgcttacctctgctactgcaagctcacagaatgcttct
cagtctcagacagaacaagaattacagtgttcctccagtagcacaccacagaatgaacaa
agtgtttccaaaattaaaagtggacaagaatgcaccaagttaatgaaaaaacccaccatg
catggcatcagcatttcctctaacaccaccatagaggcctctcaagttcaacaggtgaat
gtaacttcttcaagcttacaggagtctaggagtgactttcaagaaagtgttgtcgtttca
gccactgataccacttgtaccccatctgtgagattctccattgttgatagcttcccttca
gtaaacagcctcaaaagtaccgacttaagtagtgcaggagttcctgtgacttctgcagta
gaagctgttaaggctgtaacagcaataagcacactgcctgctagtccactagacaattgt
tggtctttttccggctcttcaggtgttggcacttctgatttgaaaaacgtgagtagcctt
acacggattccttcagctggaatcacacaaactacatggactactttgcagctagcagga
aacactgttcagccactaccccagacaccatccagtgttatgactgcattgttaaacgaa
ccagttaatggtgctggtaccataccttccacccataacagacatttggctccaagcatt
ggtttgaacacttctgtgcctggagatgggcaggcagttgaacaagttgttgttaccttg
ccctcttgcccatctgttcctgttcagccattaatgactcaaccacaagttaaaacagga
aacgttttccctttgaattcagctatgcaggtaattcagatggctcagacaattgggtca
gctgttactgcagtaccagctaatcagaatgtcataattctccaacctcctaacactact
ccatgtccccctgtggtgagagctgaagtccccagccagccagttagtcagcagattgta
attatacaagcagctaatcagaattctcttcctctcctctctgcccagacccctggttct
ctcagagttcctgtgaatggagccagtccaatagtgagctctagcagttctgtgcaaaat
gcctctgtgccacaaacttttggagggaagcatcttgtccatatattaccaagaccacca
cctttaccatcttctagcgctacacaaactttttcagttacaatgtcaaatcaacaacat
cctcaaactatttctttgaatgggcagctgtttgcattgcaacctgtgatgtcctcatct
ggagcgtcaaatcaagctcctatgcaaattattcaacctaccactagcgaagatccgaac
accaatgttgccctcaacacatttggtgctttagctaacctcaatcagagcatatcacaa
atggctggacaaagctgtttacagctgtcccttagtcagcctgctaatccaacaactgcc
cccagcagccaaattgccccaattaactgtgtttcattaccaacttctgctgcatcttca
atagctactgaaagttcaacattgttatccagtgcttctgattctataaacacttctcca
aaaaaatcttctgccagtttgccatcaaacatgaaatcaaaaagaacaaacaaaaagcca
agtactaaaaaacatttagcagccaacagcaaaacatcatgtccaatgaatccttgcaca
gatgcagggaagctggattgcactaatgtggaagttacagcagagcattcaaatagtgaa
ggattgcttgaaaacatgcccgtagtatcagaagccttagctgtatcacaagccaacagc
atggcagccccgactgatgtaaacgtttctgactgtcagtccaaagagactctgagctct
gagcagatggtgagtttaccagagctgagttcagcagaggtaccaagttcatcaccgcta
gaatctgtgatgtcagaacagtttgtgctggttccatcaagttccaaagattccactgct
cttctgcagaataacccattatctgactctgtggtgccaaaatctcccagatcatgtgtt
actaccagcatcccaatgtcctctgccactgatgcacacgtgacagtttctcaggtttct
ggggcgtcggcaccgcaaaacagtgtaacgacaggccatgcttctgaggcagaaagcatt
tcagagacctgcagtgttgggcaagaatcatcaattgagatgcaaaccacagacttatta
gaggggcaaggtctaaccaaaatgctgtctgatcttactaaagaaagaacagcggtgcta
aaaccctccttttctcttcagatggagcattctgactttccctctgaaaattctaaatca
gtaaaatcaaatgttgatttgcctgagaagcaggaacttttgttaatgaacactgaaggt
gacactctcacgcaacatcattcctgcattcctgatcaagaggttgttagcggttctctt
gttggtagcaggcaagcggactctccgctgtcaactagctctgggagcagtcgtggcttc
tcagttgcatccatgttgccagacacaactagggaagatgttaccagcagcacatcaaca
aacacatgcaacagttgcactttttcagagcaaactgatattgtagctcttgccgcaaga
gctatttttgaccaggaaaaccttgagaaaagtggaggggaaatgcaaattaatttaagg
gatggtgcttctaaatcggctgaagttgcaccttcggaaagtgagcagcaaccttttaaa
ccacaagcagctaaagctaatctaggacagttggaagcagcaccaaacaaattccatgct
caggatccagtgcaaacaaatattgatagagccgttgaaaactcagactgctctgtagga
gtggaaacctcaaatactgtacagatttcaacttcccagtcaccaaatgtaaccagttta
agtgtaaataatctcatacatcaaagccgcatcatccacccccttgtaagttgctcaggt
ttatcccagccttcagagccagcagctgttcctgccacagtgagtctgtccatatcctct
agttcctacgtcaatcagtctccaggatcagctatgatggctgaatatgctcaagatcaa
ttgagtgctattagggcaaacacgatgcagcccccacagatgcaagaaccacacttaaag
cagcaaaaccatgaaagtcgcaaagactctgctaaacgtgctgtccaagaggaccttctg
ctttctacagcaaagaggcagaagcagtgtcagacaacgcctatcagacttgaaggcatg
gcattgatgaaccgaacaccagacgcgattgctgagcaaactcaaatgttggttagtcag
atccctcctaattcatccaattcagttgtgtcagtgagcaatcaagggcacacggatggt
cttaatagattattcccatccaacaacaactttgtgacatctgctttgaggcaaactgaa
gttcagtgcagttctcagccatccatttcagagcagcaaggtcagcatttgcaatctcta
caacatgtgtcatctgttcaaggcatatctcatcttcacagtaaccacccatacttaaag
caacatcaggctgggcagttgagagagaggcatcacttatatcagctgcagcaccatgtt
cctcatgcagagagctcagtccattctcaatcccacggtgtccaccaacagagagcaatg
cagcaagaggtgcaaatgcaaaagaaacgaagccttgtccagggaacccaagccagccaa
ctttctttacagcagaagcatcatggaaatgatcaaactcggcagaaaagtggacagcct
catccccaccaccagcaaatacaacagcagatgcagcagcactttggagcttcccagcca
gaaaagaactgtgaaaacccttcaacaagtagaaaccatcataaccatcctcagagccat
ctaaatcaggatattatgcatcatcagcaacaggatgttggcaacagacagcaaggctca
ggagtttcatccgaacatgtatctggacataatcaaatgcagagacttctgacctccagg
ggcttagagcaacaaatggtgtcccagccaagtattgtaaccaggccatcagatatgacc
tgtgccccacacagacaagaaagaaacagagtttctagttattctgcagaggcgcttatt
gggaagacaccttctaattcagaacagagaataggaatatcccttcaaggcactagggcc
ccagaccagctggaaatgagaagttaccttgatgtttctaggaataaaggtttggtaatt
cataacatgcagaatcgtatatctgtagaccatgtggttggctcagatgttcaacggctt
tctgattgtcagacattcaaaccaaatggggccagccaacagccaacaggcaattttgat
gtacaagcctcaagaaatagtgaaattggtaacactgtatcatccctcaggggcatgcaa
tcacaagcttttcgaatcagtcataatactgggccacccatagagagacaaaagagattg
tcctatcaacctgttcagggtattcccacgggaaatgctcttccaccaagggacaatgaa
aatacatgccaccaaagttttatgcaaagtttacttgcccctcatcttggagatcaagtt
agtggaagccaaagatcactttcagaacatcagagaaatacacagtgcagtgtatcctcc
acaatcgaatataattgtcccccatcacgggagaatgtccacattcgaagggatagtgac
ggtcagaacagagaaagctgtgacatgtctatgggcacaattaatactaggaatagttct
ttaaatattcctttttcaagttcttcttcctcaggagatattcagggtcgaaacacaagc
ccaaatatttctgcacagaaatccaatcccatgagaatgactgacagtcatgcaaccaag
agccacatgaatacacctgtttctagcaacatgcatggagttgtccggccagctctcccc
caccctgctatctctcatgggaatgctgagcaagggcagccatctgttcgtcagccaaat
tcttcagttactcaacgatcgagacatcctctgcaggataatggtggttctaaaatccgt
cagcctgaaaggaatcgatctggcaatcaaagacatggaaatgtatttgaccctagtcta
ccccatcttcccctgtctaccggtggcagtatgatccttgggcgccaacaatctgcaata
gaaaaaagaggcagcattgtccgttttatgtctgatggccctcaagtgtctaatgataat
gcagctgctgaccagcatgctttgtctcaaaattttggattcccttttattccagagggt
agtatgaatccaccaataaatgccaatacttctttcattccaccagttactcagcccagt
gccactcgaacaccagctctaattccagtagatcctcaaaatacactgccatctttctat
ccgccttattctcctgctcatcctactctgtccaatgacatttcaatcccttactttccc
aatcaaatgtttcctaatccaagtacagagaagcccactagcggaggtttaaacaatcga
tttggatccattttatctcctcccagaccagttggttttgctcagccaagttttcctctc
ctcccagatatgccaccaatgcacatgaccaatacgtcacacttatccaattttaactta
acatctttgtttccagaaatagccacagctcttcctccagatggttctgcaatgtctcct
ttgctttcaatagcaaacacgtcagtttcagattcttccaagcaatcctcaaaccgacct
gcccacaacataagccatattctaggtcatgattgtagttcagctgtatga

DBGET integrated database retrieval system