KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102454294Help
Entry
102454294         CDS       T02980                                 

Definition
(RefSeq) caspase-1-like
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04217  Necroptosis
pss04621  NOD-like receptor signaling pathway
pss04623  Cytosolic DNA-sensing pathway
pss04625  C-type lectin receptor signaling pathway
pss05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102454294
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102454294
   04623 Cytosolic DNA-sensing pathway
    102454294
   04625 C-type lectin receptor signaling pathway
    102454294
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102454294
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pss01002]
    102454294
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pss04131]
    102454294
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     102454294
Peptidases and inhibitors [BR:pss01002]
 Cysteine peptidases
  Family C14: caspase family
   102454294
Membrane trafficking [BR:pss04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    102454294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD Milton
Motif
Other DBs
NCBI-GeneID: 102454294
NCBI-ProteinID: XP_025038731
LinkDB All DBs
Position
Unknown
AA seq 515 aa AA seqDB search
MADRQLGSVRTRFVESVSKAVINSLLDDLLEKQVLNEEEVEEVREGHSKKSDQARCLIDG
VRKKGARASEIFIRCLCCRDVHLASDLGLAAPSATAGVPVPQPGPAPQENEPGSTAETQP
APCQGWIRPCPPEDVQRIQREEAKEIYPIRDKATRTRLALIICNVEFEHLPRRGGADVDV
SGMQRLLEGLGYKVGTYGSPPAQDMLATLKQFAARDEHQTSDSTFLVLMSHGVRAGLCGT
KSHGGATDILPVDTIYSTFNNKSCQALLGKPKVIIIQACRGESQGHVWVSDSAELPGDGA
SPAPWPTEELEDDATHQIHVESDFICFHSTTPGTCCQGTGWGWGSAGTCTLNTPVCPGSL
PAPRPPPGQPSGPRPPSHSLGLEALSSPPLCTSEPVWGAALCPAQGFPGLCPWPLSPCSP
DQLARLRSPFRPVALSSRPALSCHPAHGSTQSPSPSPWSTACGAVGLFPTPPSPSASPRS
FFAFQSLLHGLPESPGGPLLSLLGIADNQRTVPPP
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcggcagctcggcagcgtgcggaccaggttcgtggagagcgtgagcaaagcc
gtgatcaactccctcctggacgacctgctggagaagcaggtgctgaacgaggaggaggtg
gaggaggtgagggaaggccacagcaagaagagtgaccaagccaggtgtctgatcgatggg
gtgaggaaaaagggagccagagccagcgagatcttcatccggtgcctctgctgcagagac
gtgcacctggccagtgacctggggctggcagccccctcggctaccgcaggggttccagtg
ccacagccagggccggccccccaggagaacgagccagggtccaccgcagaaacccagcca
gccccatgccagggctggatccggccctgccccccggaggacgtccagcggatccagagg
gaggaagcaaaggagatctatcccatccgggacaaggcaacacgaacccgcctggccctc
atcatctgtaacgtagagttcgagcatctccccaggcggggcggggccgacgtggacgtg
agtgggatgcagaggcttctagaggggctgggctacaaggtgggaacctacggatctccc
cccgctcaggacatgctggcaacgctgaagcagtttgctgctcgggacgagcaccagacc
tcggacagcaccttccttgtgctcatgtcccatggcgtccgggcagggctgtgcgggacg
aagagccacggcggggccacggacatccttcccgtcgacaccatctacagcaccttcaac
aacaagagctgccaggccctgctgggcaagcccaaagtgatcatcatccaggcctgccgg
ggggagagccagggacacgtgtgggtgagcgactccgcagagctccctggagatggcgcc
agccctgcgccatggcccaccgaagagctggaagatgatgccacccaccaaatccacgtg
gagagcgatttcatctgcttccactccacaacgccaggtacctgctgccagggcacaggc
tggggctggggctctgctgggacgtgcaccctgaacaccccggtctgcccggggtccctc
ccagccccccggcctcctcctggccagccctcggggcctcgtcctcccagccactcgctg
ggcttggaggcactgtcctcccctcccctctgcacatcagagcctgtgtggggggctgcc
ctgtgccctgctcaggggttcccagggctctgcccttggcccctttccccttgctccccg
gaccagctcgcaagactccgctcccctttccgcccggtggctctcagctctcgcccggct
ctgtcctgtcaccctgcgcacggctcaacccagagcccttccccttcaccgtggtcgaca
gcctgtggggctgtgggcctgtttccgaccccgccctctccctcagcatcgccaagatcc
ttctttgccttccaatccctcctgcatgggctcccagagtcccctggagggcccctgcta
tccctcttggggattgctgacaatcagcgaactgttcctccgccctga

DBGET integrated database retrieval system