KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102454880Help
Entry
102454880         CDS       T02980                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3-like isoform X1
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102454880
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102454880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102454880
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102454880
Protein kinases [BR:pss01001]
 Serine/threonine kinases: STE group
  STE11 family
   102454880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like SAM_MT
Motif
Other DBs
NCBI-GeneID: 102454880
NCBI-ProteinID: XP_006120626
Ensembl: ENSPSIG00000008546
UniProt: K7FN71
LinkDB All DBs
Position
Unknown
AA seq 620 aa AA seqDB search
MDEEEALNSIMKDLAALGKCRGLLDSNRNKNSVHSSKQQRNARIKFEYDGEKRILQFPRP
IKFKEVLQKVMDAFGQMMDLHYANNELLIPLKSQEDLDRAVEHLDLSPSLKSLRVVVKAP
RKANFLQPNSKQHEMRISKSMGDIMGSLCKDAERTRKYSTGSLHTGRSSPPPGSVPEEQQ
QIARQGSYTSINSEGEFIPEIMEQTMLEPFISPGESLSGSCQSLDQSIDSPPFTQSPVPR
RKSQAKDSLDCLDFDIPFCDRFGKGGTFPRQYHLSQSRKDYSDGRRTFPRSYIPQENQFQ
LVPSSRTKSFTGDSKLLTLQYEKHRTKWWLDCDKGLQVFNKSPSKSRNSLQAPVNWRLGK
LLGRGAFGEVYLCYDADTGRELSVKQVPFDPDSQETSKEVNALECEIQLLKTLRHDRIVQ
YYGCLRDPEERKLSIFVEYMPGGSIKDQLKAYGALTENVTRKYTRQILQGVFYLHSNMIV
HRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIQSVTGTPYWMSPEVISGEGYGR
KADVWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTKPQLPDGVSDCCRNFLKQIFVE
EKRRPTAEDLLRHPFMTCSL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaggaagcgcttaactctattatgaaggatctggcagcactgggcaaatgc
agaggactgctggatagcaacaggaacaaaaacagcgtccactccagcaaacagcagcgg
aatgccaggatcaagtttgaatatgatggagagaaaaggattctccagtttccaaggcca
atcaaattcaaagaagtgctacagaaggtcatggatgcttttgggcagatgatggatttg
cactatgcgaacaatgagctcctgatcccgctgaaatcgcaggaagacttggaccgcgca
gtggagcacttggaccttagcccttctctgaagagcctgagggtggttgtgaaggctcca
aggaaagcgaactttctccagcccaacagtaagcagcatgaaatgagaatatctaagtcc
atgggtgacatcatggggtccctgtgtaaagacgctgagaggacgcggaagtattcaaca
ggttccctgcacacgggccggagttccccacccccagggagcgtgcctgaagaacagcag
cagatcgcacggcagggctcctacactagtattaacagcgaaggggaattcatccctgag
attatggagcagactatgcttgaacctttcatcagccctggcgagtcactctctgggagc
tgccagtccctggaccaatctatagacagcccaccctttacccaaagccctgttcccaga
aggaagagccaagccaaagacagtcttgattgcctggatttcgacatcccgttttgtgac
cgattcgggaaaggcgggaccttccccagacaatatcacctttcgcagagccgtaaagac
tatagcgacggtcgaaggactttcccgaggagttacatccctcaggagaaccagtttcag
cttgtcccctccagcagaaccaagagcttcaccggggacagcaagctcctgaccttgcag
tacgagaagcacaggaccaaatggtggctggactgtgacaagggactgcaggtcttcaac
aagtcccccagcaagtccaggaattctttgcaggcgcctgtgaactggaggctggggaag
ctgcttggcagaggggccttcggggaggtttacctctgctacgatgcggacaccggcaga
gagctctcggtgaagcaggtgccctttgacccagacagtcaagagacgagcaaggaagtc
aacgccttagaatgtgagatccagctgttgaagacgctccgccatgacaggatagtccag
tattacggttgtttgcgggacccggaggagaggaagttgtctatctttgtggaatacatg
ccagggggttccataaaggaccaattaaaagcatacggtgctctgactgagaacgtcact
cggaagtacaccaggcagattctgcagggagtcttctacttacacagcaatatgattgtc
caccgggatattaaaggtgccaatattttgcgagattctgctgggaatgtgaaactagga
gattttggagccagcaaacggatccagaccatctgcatgtcaggaactggcattcaatct
gtcaccgggacaccatactggatgagcccagaggtgatcagtggagaaggctatggaagg
aaagctgacgtgtggagcgtgggctgtactgtagtggagatgttaacagaaaagccaccc
tgggcagaatttgaagccatggcggccattttcaaaatagccactcagccgaccaaaccc
cagctcccggacggcgtctcggactgctgccgcaacttcctcaagcagatctttgtggag
gagaagcggcggcctacagcagaggacctgctgagacatcctttcatgacctgcagtctc
tag

DBGET integrated database retrieval system