KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102454892Help
Entry
102454892         CDS       T02980                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1 isoform X1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04217  Necroptosis
pss04621  NOD-like receptor signaling pathway
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102454892 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102454892 (JAK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102454892 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102454892 (JAK1)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102454892 (JAK1)
Protein kinases [BR:pss01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102454892 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 Kinase-like SH2 FERM_M APH
Motif
Other DBs
NCBI-GeneID: 102454892
NCBI-ProteinID: XP_014430054
Ensembl: ENSPSIG00000009400
LinkDB All DBs
Position
Unknown
AA seq 1181 aa AA seqDB search
MQYLNVKEDCKAMAFCAKLRNSKKSEVTTEAREQGLEIVFYLQEKPPIWYTSGEYTAEDL
CIEAAQKCAVSPLCHNLFALFEESRKLWYAPNHVFKIDDKTALRLYYRMRFYFTNWHGTS
ENEPSVWRHSPKKPKNSYEKKLVPYGAPILDTSPKKQKNSYEKKLVPDGTPILDANSLEY
LFAQGQYDLVKCLAPVRDPKNDQEVHEIENECLGMAVLAISHYAIKKNMKLPELPKDISY
KRYIPETLNKTIRQRNILTRIRINNVFKDFLKEFNNKTICDSSVSPHDLKVKYLSTMETL
TKHYGAEIFETSSLQISTENEKHGFNLGDNGIMPQYEVMVTGNNGIQWRRKPNVIQPERE
KHNKLKRKKMDSKNRKGEEKNKSREEWNSFSYFPEITLLVIKESTININKQNHEKMEIKL
SSHEEALSFASLVDGYFRLTADAHLYLCTDVAPPLIVHNIRNGCHGPICTEYAINKLRQE
GNEEGMYVLRWSCTDFNHILMTVTCSEISQQRLNESVQYKNFQIEVTKDGCFLHGPNKFF
PSLKELMDHLKGQTLRTDNISFTLKRCCQPKPKEISNLLVATKKGQEWHPVCPLGQLSFH
RILKEEILQEEHLGRGTRTQIYSGILNYKADENDGYQDEKEKKVLLKVLDPSHRDISLAF
FETASMMRQICHKHIVFLHGVCVRDVENIMVEEFVEFGPLDLFMHRKSDVLTTPWKFKVA
KQLASALSYLEDKELVHGNVCTKNILLAREGIDHEYGPFIKLSDPGIPITVLSRQECVER
IPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEAPLKDKTLAEKERFYEGHFMLVTP
SCKELADLMKQCMNYDPNQRPFFRAIMRDINKVEEQNPDIVSEKTPFAEVDPTLFEKRFL
KRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHE
NIVKYKGICIEDGGSGIKLIMEFLPSGSLKEYLPRNKSKITLKHQLRYAVQICKGMDYLG
SRQYVHRDLAARNVLVESENRVKIGDFGLTKVIETNKEYYTVKDDLDSPVFWYAPECLLQ
SKFYIASDVWSFGVTLYELLTYCDSESSPMAEFLKMIGPTQGQMTVTRLVRVLGEGKRLP
RPPNCPEEVDQLMRKCWINNPGDRTTFQNLIQGFEALINKL
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatgtaaaagaggattgcaaagccatggctttctgtgcaaaactgaga
aactcaaaaaaaagtgaagtgaccacagaagcacgagagcagggattggaaatcgtattc
tatttgcaagagaagcctcccatttggtataccagtggcgagtacacagcagaagacctg
tgtattgaagctgcccagaagtgcgctgtatctccattgtgccacaatctctttgcgcta
tttgaggagagtagaaaactctggtatgcaccgaaccatgttttcaaaatagatgacaag
acagccctccgactctattatcgcatgaggttttattttacaaactggcatgggacaagt
gaaaacgagccatcagtctggaggcattctccaaaaaaaccaaagaattcctatgagaag
aaattagtgccatatggagctcctatccttgacacatctccaaagaaacaaaagaattct
tatgagaagaaactagtgccagatggaacccctatccttgatgcaaattcattagaatat
ctctttgcacagggacagtatgatttggtgaagtgcctggcaccagttcgagaccctaaa
aatgatcaggaggttcatgaaattgaaaatgaatgtctgggaatggctgtccttgcaatc
tcgcactatgccatcaagaaaaatatgaagctaccagagcttcccaaggatatcagttac
aaacgctatattcctgaaactttgaataagaccatcagacaaaggaatatcttaacgaga
attcggataaataatgttttcaaggatttccttaaggagttcaataataaaaccatttgt
gacagcagtgtctctccgcatgatctgaaggttaaatacttatcaacaatggagacttta
actaagcattatggagcagaaatttttgagacttcatcattgcagatttcaacagagaat
gaaaaacatggatttaatttgggagacaatgggatcatgccacaatatgaagtgatggtg
acaggaaacaatggaatacagtggaggcgcaaaccaaatgttatacagcctgaaagagag
aaacataataaactgaagaggaaaaaaatggacagcaaaaacaggaaaggtgaagaaaaa
aacaaaagccgagaggagtggaacagtttttcatattttcctgaaatcacactacttgtc
ataaaggagtccacaatcaatattaacaagcagaatcatgaaaagatggaaataaaactt
tcttcacacgaggaggccttgtcatttgcatctttagtagatggatacttcagacttact
gcagatgcccacctctatctctgcactgatgtagctccacctttgatagtgcacaacata
agaaatggctgtcatggacccatttgcacagagtatgccatcaacaaattaagacaagaa
gggaatgaggaggggatgtatgtgctgaggtggagctgtacagactttaatcacatcctc
atgacagtgacatgttctgaaatctctcagcaaagactaaatgagtcagtccagtacaag
aacttccagatcgaggtgacaaaagatggttgcttccttcatggtccaaataagtttttc
ccatctttaaaagaactgatggatcacttgaagggacagacccttagaacggataacata
agctttacgctgaagagatgctgccagccaaaaccaaaagaaatctcaaacttgttagtg
gcaacaaagaaaggccaggaatggcatcctgtttgccctctaggtcaactgagtttccat
cgaatcctcaaagaagaaattctgcaggaagaacaccttggaagaggaacaagaacacaa
atttactctgggattctcaattataaggcagatgagaatgacgggtaccaggatgaaaaa
gagaaaaaagtcctcctcaaagtcttggaccccagtcacagagacatttctttggcattt
tttgagacagcaagcatgatgaggcaaatttgccacaaacacatcgtcttccttcatggg
gtctgtgtccgtgatgtagaaaatatcatggttgaagagtttgttgaatttggaccactg
gatctctttatgcaccggaaaagtgatgttcttacaactccttggaaattcaaagtagcc
aaacagctggcaagtgcattaagctacttggaggataaagagttggtacacgggaatgtt
tgcacaaaaaatatactgttggcaagagagggaattgaccatgaatatggtcctttcatt
aaactgagtgacccaggaattccaataactgtgctatccagacaagaatgtgttgaacga
atcccttggattgcacctgaatgtgttgaagattcaaaaaatttaagtgttgcagcagat
aagtggagttttggcacaacactgtgggaaatctgctacaatggagaagcacccctgaaa
gataagacgttagcagagaaggagagattctatgaagggcatttcatgttggtaacacca
tcctgtaaggaactagctgatctcatgaagcagtgcatgaactatgaccccaatcagagg
ccatttttcagagccattatgagagacatcaataaagtggaagaacaaaatcctgatatt
gtctctgagaagacaccatttgctgaagttgatcctactctctttgaaaaacggtttttg
aaaagaatccgagatttgggagagggtcactttggcaaagttgaactctgcaggtatgat
ccagaaggtgataatacaggagagcaggtggcagtcaagtctctgaaacctgagagtggt
ggaaatcatatcgctgatctgaagaaagaaattgaaatcttgaggaatctttatcatgaa
aacattgtcaaatacaaaggaatttgcatagaagatggaggaagtgggatcaaactcata
atggagtttcttccatctggaagcctaaaggaatatctcccacgaaataagagcaaaatc
actctcaaacatcagctccgttatgcagttcagatctgcaagggaatggattatttgggc
tctcgtcagtatgttcaccgggatttagcagcaagaaatgtcctagttgaaagtgagaac
cgagtgaagattggggattttggcctcaccaaagtaattgaaaccaataaggagtactac
acggtcaaagatgatctcgacagtcctgtgttttggtatgctccagaatgtctgcttcag
agcaagttttatattgcttcagatgtctggtcatttggagtgacgctatacgaactactg
acctactgtgattcagagtccagtccaatggcggaatttttgaaaatgattggcccaact
caaggccagatgacagtaacaaggcttgtgcgtgtattaggagaaggaaaacgcttgcca
cgtccgccaaactgcccagaagaggtggaccaactgatgaggaaatgttggataaacaat
ccaggtgaccggacgacctttcaaaatcttattcaaggatttgaggctcttataaataaa
ttataa

DBGET integrated database retrieval system