KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455008Help
Entry
102455008         CDS       T02980                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04012  ErbB signaling pathway
pss04137  Mitophagy - animal
pss04210  Apoptosis
pss04310  Wnt signaling pathway
pss04510  Focal adhesion
pss04530  Tight junction
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04625  C-type lectin receptor signaling pathway
pss04912  GnRH signaling pathway
pss04933  AGE-RAGE signaling pathway in diabetic complications
pss05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102455008 (JUN)
   04012 ErbB signaling pathway
    102455008 (JUN)
   04310 Wnt signaling pathway
    102455008 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102455008 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    102455008 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102455008 (JUN)
   04530 Tight junction
    102455008 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102455008 (JUN)
   04621 NOD-like receptor signaling pathway
    102455008 (JUN)
   04625 C-type lectin receptor signaling pathway
    102455008 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102455008 (JUN)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102455008 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102455008 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102455008 (JUN)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    102455008 (JUN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha Jnk-SapK_ap_N FlaC_arch NBP1 TSC22 DUF3450 Spc29
Motif
Other DBs
NCBI-GeneID: 102455008
NCBI-ProteinID: XP_006133565
Ensembl: ENSPSIG00000000515
UniProt: K7EXL0
LinkDB All DBs
Position
Unknown
AA seq 314 aa AA seqDB search
MTAKMEPTFYDDALNATFVQPESGGYGYNNPKVLKQNMTLNLADPSSNLKPHLRNKNADI
LTSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHNQNTMPSVTTAAQPVSSGMTPVSSMAGNNGFNTSLHSEPPVYANLSNFNPSALSTAPN
YNANNMGYPPQHHINPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAER
KRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVN
SGCQLMLTQQLQTF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaacctacattctacgatgatgccctaaatgctacctttgtacag
ccagaaagtggtggttatggatataataaccctaaagtcctgaagcagaatatgacacta
aatctggctgatccttccagcaacctgaagccccacctcaggaacaagaatgctgatatt
cttacctccccagatgttggtctcctgaagctggcatctcctgaactggaaaggctaatc
atccagtccagcaatggcttgatcaccactactcccaccccaacacagtttctgtgtccc
aaaaatgttactgatgagcaagaagggtttgctgaaggttttgtgagagctctggcagag
ctacacaatcagaatacgatgcccagtgttacaactgctgcccaaccagttagcagtggt
atgacacctgtttcatctatggctggcaacaatggtttcaacaccagtttgcacagcgaa
cctccagtgtatgctaatctcagcaactttaaccctagcgcactcagcacagcacctaac
tacaatgcaaacaacatgggctacccacctcagcatcacattaatccacagatgccagtg
cagcatcccaggctccaagctctgaaagaagaacctcaaactgtacctgaaatgccagga
gagactcctccactgtcccccattgatatggagtcacaggagaggatcaaggctgagagg
aagcgcatgagaaacagaattgcagcctccaaatgccggaaaaggaagttggaaaggatt
gccagattggaagaaaaagtgaaaactttgaaagcccagaactcagaactggcatccact
gccaacatgctcagagaacaggttgcacagcttaagcagaaggtcatgaaccatgtcaac
agtgggtgccaactaatgctaacacaacagttgcaaacattttga

DBGET integrated database retrieval system