KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455030Help
Entry
102455030         CDS       T02980                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X3
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00020  Citrate cycle (TCA cycle)
pss00190  Oxidative phosphorylation
pss01100  Metabolic pathways
pss01200  Carbon metabolism
Module
pss_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pss_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pss_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102455030 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102455030 (SDHA)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102455030 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 GIDA Pyr_redox_2 FAD_binding_3 DAO Thi4 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 102455030
NCBI-ProteinID: XP_006114284
Ensembl: ENSPSIG00000007382
UniProt: K7FJ24
LinkDB All DBs
Position
Unknown
AA seq 303 aa AA seqDB search
MAVSTGVASRGLVKRLFRHPVGVWPAACQTLARNFHFTVYGKKNASAKVSDSISTQYPVV
DHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDN
WRWHFYDTVKGSDWLGDQDAIHYMTEEAPAAVVELENYGMPFSRTEEGKIYQRAFGGQSL
QFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECCGVIALC
IEDGSIHRLRAKNTVIATGGYGRTFFSCTSAHTSTGDGTALVTRAGLPCQDLEFVQFHPT
GTI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcaaccggcgtcgcgtcgcgggggctcgtgaagcgattgttccgacacccg
gtgggagtgtggccagcagcttgccagactcttgcacgtaactttcacttcacggtctat
ggaaagaagaatgcatctgctaaagtttctgattcgatttctacacaatatcccgtagtg
gaccatgaatttgatgctgttgttgtgggcgctggtggggcgggcttgcgggctgcattt
ggtttgtcagaggctggatttaatacagcatgtgttacaaagctgttcccaaccagatcc
catactgttgctgcacagggagggatcaatgctgctttgggaaacatggaagaagataac
tggagatggcacttctatgacactgtgaaaggatctgactggttgggggatcaggatgct
attcattacatgacagaggaagcacctgctgcagttgtagagctggaaaattatggaatg
ccatttagcagaacagaagaagggaagatctatcaacgtgcctttggtggacagagcctc
cagtttgggaaagggggacaggctcatcgatgttgttgtgtcgcggacaggacaggacac
tcactgttgcacaccttgtatggcaggtctctacgatatgataccagctactttgttgag
tattttgccttggatctcctgatggaaaatggtgaatgttgtggggtcattgcactttgc
atagaagatggatcgatacatcgtttaagagcaaagaacactgttattgccactggtgga
tatggccgcaccttcttcagttgcacatctgctcataccagcacaggtgatggcacagct
ctggtcacacgagctggccttccttgccaggacctagaatttgtacagttccatcctaca
ggtacaatataa

DBGET integrated database retrieval system