KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455080Help
Entry
102455080         CDS       T02980                                 

Gene name
DOT1L
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102455080 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pss03036]
    102455080 (DOT1L)
Enzymes [BR:pss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102455080 (DOT1L)
Chromosome and associated proteins [BR:pss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102455080 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 102455080
NCBI-ProteinID: XP_025043502
LinkDB All DBs
Position
Unknown
AA seq 1736 aa AA seqDB search
MTLPSPPLLSSKERPRFPNEYMDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDT
KSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVTDPEKL
NNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCKHHYGV
EKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWKERIANTSVIFVNNFAF
GPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSW
TGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKVQDNKDS
GAEEEKVGTNAIKKTSPSKARKKKLSKKGRKMAGRKRGRPKKMNTANTERKTKKNQTALE
LLHAQTVSQTSSSSPQDAYKSPHSPYYQLPPKVQRHSPNQLLVTPTPPALQKLLDSFKIQ
YMQFMAYMKTPQYKANLQQLLEQEKEKNAQLLGTAQQLFTHCQAQKEEIKRLFQQKLDEL
GVKALTYNDLIQAQKEISAHNQQLKEQTKQLEKDNSELRNQSLQLLKARCEELKLDWSTL
SLESLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELMQLKSYMPPDESLSVQLR
NKNRLGRETEADHGRFQLELECSKFPMPHINGMSPELSMNGHATPYEIHNALSRPSSKQN
TPQYMTSHLDQEIIPCTPNHSSRQKVDKTASLSLPDYTRFSPAKIVLRRHLNQDHAVNGK
ATTNEIHQRADHVKENGLTYPSPGISNGIKLSPQETRPSSPAALPIAGEKVLRERTSASN
GETITSLPISIPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSPVHQNRDSLSTLEKQF
GASSHNGVSNAAGNKPLALATSGFSYSSGSMAVNGTLSNSPAHLNHGVDQAAVDDSGSLF
SSVGSRSSTPQHPSLLMLQSRNSGQNSPAHQHSASPKLNGAPQSMVGALQYGDAQKMFAE
GTKGDFQPDAAFSDPENEAKRRIIFTISPSTGSVKQSPSNKHSPLAASIRMDCGQAHMQD
GKKRGRRKRSSNGNLNLNSGVSPKRKSLPTVAGLFTQPSGSPLNINSMVNNINQPLEITA
ISSPENSLKNSPVPYQDNDQPPVLKKEKPLSQTNGVHYSPKTSRSTVEXPFSFLARIERK
IATISLESKSPPKTIENGGSLAGRRQAQTSENINSSKWKSTFSPISDINLTKTTDSPLQA
VPSLSQNSLFAFRPSSEDGMAIDAKIAAHTRKNITMSSSGTDGLSSNTNSTNGAMYNGGL
TADLGLHSFTDGASLPHKNSDVSALNASLGFQSQRSKDVGILETNPFLNKRQLEGLVSMK
GEDLNRPGVKSKELSELTIRPGASDKSSLQHNGKASKGRDRDVEFKNGHNLFISAATVSS
GGLLNGKSLSTGVSPAGNPAPAVQTHHPFLNTLTTGSQFPLGPMALQANLNSVTNSSVLQ
SLFNSMPAAASLVHVSSATTRLTNSHAMGNFSPGVTGGTVGGIFNHAVPSASSSHQFGAS
FSSSAVSSSTMLSLNPLQAVVSTSSFQSPSSSLVTSSENRAVQHLNRAPMQSVFHTPPPP
PPNVSLPPPPPLLASNSEPVLLQNLASIPANDAFLPSSSAASVQSANASLSIKLASLQHK
TSRPSFTVHHPPLPRLALAQTAPVIPQSNATGTSAMWVTLGMQSPYASHLSGVKPR
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atgactcttccctccccccctttgctttcctcaaaggaaaggccacggtttcctaatgaa
tacatggacaaacaccatgatgctgctcatgaaatcattgagacaattcggtgggtctgt
gaagaaatcccagatctcaagcttgctatggaaaattacgttttaattgactatgataca
aaaagctttgaaagcatgcagaggctttgtgacaaatacaaccgagccattgatagcatt
catcagttgtggaaaggaactacccagcccatgaaactgaacactcgtccctccaatggg
ctcctccgtcacatcttgcagcaagtatataaccactcggtgactgacccagagaaactc
aacaactatgagcccttttccccagaggtgtatggagagacttcatttgatttagtggcc
caaatgattgatgagattaaaatgactgaggatgacttgtttgttgacttgggcagtggt
gtgggtcaggtggtgcttcaagttgctgctgccacaaactgcaaacatcactatggtgtg
gagaaagctgatattccagccaaatatgctgagacgatggacagagagttcagaaagtgg
atgaaatggtatgggaaaaaacatgcagaatacacactggagagaggtgatttcctctca
gaagaatggaaagagagaattgcaaacacaagtgttatttttgtgaataattttgccttt
ggtcctgaggtggatcaccaactgaaggagcgatttgcaaacatgaaggaaggtggcaga
atcgtgtcctcaaagccttttgcacctctaaactttagaataaacagtcgaaacttgagt
gatattggcactataatgagagttgtggagttatcaccactgaaagggtcggtttcatgg
actgggaaaccagtttcttactacctgcatactattgatcgtaccatacttgaaaactat
ttttctagtctcaaaaatccaaaactcagggaggaacaagaggcagctagacgtcgccag
caaagagaaaacaagagcaacacaactactccaacgaaggtgcaagataacaaggattct
ggtgctgaagaagaaaaagttgggacaaatgccattaaaaagacatctccttccaaagca
cgcaagaaaaagctgagtaagaaaggaaggaaaatggcagggcggaagcgaggacgtccc
aagaaaatgaacaccgcaaatacagagcgcaagaccaagaagaaccaaactgcactggag
cttctgcatgctcaaactgtgtcacagacatcctcatcctctcctcaggatgcatacaag
tcacctcatagtccatattaccaactacctcctaaagtgcaacggcattcgcctaaccaa
ctgttagtgactcctacccctcctgcactacagaagctgctagactcttttaagatccag
tacatgcagttcatggcgtacatgaaaactccccaatacaaagcaaacctgcaacagtta
ctggagcaggaaaaggaaaagaatgctcagttactggggacagcacaacagttattcacc
cactgccaggcacagaaagaggaaatcaaacggctttttcaacagaaacttgatgagttg
ggagttaaggctctgacgtataatgacctgattcaggctcagaaggagatttctgctcac
aaccagcagctgaaggaacagacaaagcagctggagaaagataacagtgaactcaggaat
cagagcttgcagctgcttaaagcacgatgcgaagaactgaagctggattggtcaacactg
tccctggagagcttactgaaggaaaagcaggcactgaaaaatcagatttccgagaaacaa
aagcactgtttggaattgcagatcagcattgtggagcttgagaaaagtcaaaggcagcag
gagctcatgcagctgaaatcgtatatgccgcccgatgaatctctgtcggtacaactacgc
aataaaaatcgtttaggccgtgagactgaggctgatcacggcagattccaacttgagctt
gagtgctctaaatttcctatgcctcacatcaatggcatgagccctgaactgtccatgaat
ggccatgctactccctatgaaatccataatgctcttagcaggccctcttctaagcagaat
acccctcaatacatgacctctcacctggaccaagaaataatcccttgcaccccaaaccac
agcagcagacagaaggtggacaagacagcaagcttgtccttacctgattacaccaggttt
tccccagctaagatagtcctaaggagacacttgaatcaggaccatgcagtcaatggaaaa
gcaacaactaatgagatacatcagagagctgaccatgtaaaagagaatggccttacatat
ccaagccctggaatttcaaatggcataaagctgagtcctcaggaaactcggccctcttcc
ccagcggccttaccgattgcaggagagaaggttttgcgagagaggacttctgcaagtaat
ggagaaactatcaccagcctacctatcagtattcctctcagcacggtgcagcccaataaa
ctccctgttagtatccctctggccagcgtagtcctacctagccgtgttgagaaggtgaga
agcacacctagtccagttcatcagaatcgagactcgttgtcaacacttgaaaaacagttt
ggtgctagttctcataatggtgtgagcaatgctgctggaaacaagccactggctttggct
acctcaggtttttcatattcttctggctccatggcagttaatggaactctttcaaatagc
ccagcccaccttaaccatggtgttgatcaggcagctgtggacgactcggggagcctgttt
agctctgtggggtctcggagctccactccacaacacccttctttgctaatgctgcagtca
cggaactccgggcagaactccccagctcaccagcactcagcaagccccaagttaaatggt
gccccccagagtatggtaggggcactgcagtacggggatgcacagaagatgtttgccgaa
ggaacaaagggagattttcagcctgatgccgctttttcagatccggagaatgaggccaag
agaagaatcatcttcacgatttctcctagtacaggaagcgtgaaacagtctccttctaac
aagcacagccccctggctgcaagcattcggatggactgtggccaagcacacatgcaggat
gggaagaaacgtggtcgaaggaagagatcctccaatgggaatctgaatctgaattctggg
gtgtcccctaaacgcaaatccttaccaaccgtggctgggctctttacacagccctcgggg
tcaccactcaatattaactccatggtcaataacattaatcagcctttagaaataacagcc
atttcctcccctgaaaactccctgaagaactctcctgttccctaccaggacaatgaccag
cctccagtgttgaaaaaagagaagcccctgagtcagaccaacggcgttcattactcgccc
aagacttcaagaagcactgtggagtaacctttttcttttcttgctagaattgagaggaaa
attgctacaatatcattggagagcaaatctccaccgaagactattgaaaatggtggcagt
ttagctgggaggagacaagcacaaaccagtgagaacatcaatagcagtaaatggaagtct
accttttcgccaatttcggacatcaacctgaccaaaacgacagatagcccattgcaggct
gttccatctctgagccagaattctctgtttgcctttaggccatcctctgaagatggcatg
gccattgatgccaaaattgcagcacatacaaggaaaaacatcactatgtcctcctctggg
acggatggactcagctccaatacaaactccactaatggagccatgtacaatggtgggctg
accgcagaccttggtttacacagctttactgatggtgcttctcttcctcataagaattca
gatgtgtcagccctcaacgcctcgctgggttttcagtcccagcggagcaaagatgtgggg
attctggagacaaatccctttttgaacaagaggcagcttgaaggcctagtcagcatgaaa
ggagaagacttaaaccggccaggggtcaaaagtaaagagctcagtgaactaaccattcgt
ccaggagcttctgacaaaagttccttgcagcacaatggcaaggccagcaaaggacgggac
cgagatgtggagtttaaaaatggccacaaccttttcatttctgctgctactgtatcttct
ggtggccttctcaatggcaaaagcctttccactggtgtctcgcctgcaggcaacccagcg
cctgctgttcagacgcaccatcctttcttaaacaccttgaccactggatcgcagttcccc
ctgggccccatggctttgcaggcaaacctcaactcggtcaccaactcctcagtattgcag
tccttatttaattcaatgccagctgctgccagtctggtccatgtctcatcagctacaacc
agactgactaactctcatgctatggggaacttctctcccggggttacaggtggaacagtt
ggaggtatttttaaccatgcggtgccttctgcctcctcttctcatcagtttggagccagt
ttcagcagcagtgctgtttctagcagcacaatgctaagcttaaaccctctgcaggctgtt
gtcagcacctcctccttccagtccccctcctctagcttagtgacatccagtgagaacaga
gccgtgcaacacctaaacagagcgccgatgcagtctgtttttcatacccctcctccaccc
cctcctaatgtttcattgccgcctcctcctccattacttgcttctaactctgagcctgtg
cttctgcaaaacttggcatccatcccagctaacgatgcttttttaccatcctcttctgct
gcttctgtccaatctgctaatgcttccttgtctattaagctagcttctcttcagcacaaa
acttcccgtccctcctttactgtccatcaccctcctctgccccgtttggcgttggcacag
accgcgcccgtgatcccgcagtccaacgcaactggcacgtctgctatgtgggttacactt
ggcatgcagtctccttatgcttcgcacctttctggggttaagccacgataa

DBGET integrated database retrieval system