KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102456466Help
Entry
102456466         CDS       T02980                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog isoform X1
  KO
K03355  anaphase-promoting complex subunit 8
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04110  Cell cycle
pss04114  Oocyte meiosis
pss04120  Ubiquitin mediated proteolysis
pss04914  Progesterone-mediated oocyte maturation
Module
pss_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:pss00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102456466 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102456466 (CDC23)
   04114 Oocyte meiosis
    102456466 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102456466 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pss04121]
    102456466 (CDC23)
   03036 Chromosome and associated proteins [BR:pss03036]
    102456466 (CDC23)
Ubiquitin system [BR:pss04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102456466 (CDC23)
Chromosome and associated proteins [BR:pss03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102456466 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 ANAPC8 TPR_2 TPR_8 TPR_14 TPR_19 TPR_16 TPR_7 TPR_11 ANAPC3 TPR_17 TPR_12 DUF772 TPR_9
Motif
Other DBs
NCBI-GeneID: 102456466
NCBI-ProteinID: XP_006121693
LinkDB All DBs
Position
Unknown
AA seq 589 aa AA seqDB search
MGKMAAAAVVLGLGSCDFSDLREIKKQLLSVAERSRERGLQHSGKWASELAFALDPLPLS
ELPAVPALTEEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEK
KKDDETVDSLGPLEKGQVKNEALRELRVELSKKHKAQELDGFGLYLYGVVLRKLDLVKEA
IDVFVEAVHVLPLHWGAWLELCNLITDKEMLKGLSLPDTWMKEFFLAHIYTELQLIEEAL
QKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLY
VRSMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAW
TLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQL
RPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQ
CYIKYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTREEGKA
LLRQILQLRNQGETSSTEIAAPFFLPASLSSNNTPTRRVSPLNLSSVTP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatggcggctgcagcggttgtgctcggtttgggaagctgcgatttttctgac
ctgcgagagatcaagaagcagcttctgagcgtagcggagcggagccgcgagcggggcctg
cagcatagcgggaaatgggcctccgaattggcatttgccctggatcctctgcctctgagc
gagctgcctgcagttcctgcgctcacagaggaggatgctcgtgatttggatgcctacaca
ttagctaaatcttacttcgatctgaaggagtatgacagggctgcatactttctgcgggga
tgcaagagtcagaaggcctacttcttgtatatgtattccagatacctgtcaggagaaaag
aagaaagatgatgaaaccgttgatagtctgggccccttggagaaaggacaggtgaagaat
gaagcactaagagagttaagggtggagcttagcaagaaacacaaagcacaggagctggat
ggttttggcctttatctgtatggtgttgtgctgcggaagctggacctggtaaaagaggcc
attgatgtgtttgttgaagctgtccatgttttgcctttgcactggggagcctggctggaa
ctctgtaatctgatcacagacaaagagatgctgaagggtctgtccttgccagacacgtgg
atgaaggagtttttcctggcacacatttacacagagttgcagctgatagaagaagctctg
cagaaataccagagtctcattgatgcgggtttttccaagagcacatacataatttcccag
attgcagttgcctaccataatatcagagacatagacaaagctctctctatcttcaatgaa
ctaaggaaacaagacccatacaggatagaaaacatggacaccttctccaacctgctgtat
gttcggagcatgaagcctgagctgagttacctggctcacaatctgtgtgagattgacaag
tatcgtgtggagacgtgctgtgtgatagggaattactatagtctgcgctctcagcatgaa
aaagcagcactctatttccagagagccttgaaattgaaccctcggtatcttggagcctgg
accctcatgggacatgagtacatggaaatgaagaacacatctgcagctatccaagcttat
agacatgcaatagaggtgaacaagagggactacagagcctggtatggacttgggcaaact
tatgagatcctcaagatgccattttactgtctgtattattaccgacgggcccaccagctc
aggcccaacgattcccgtatgctggttgctctgggagagtgttatgagaaactcaatcag
ctggtagaagctaaaaagtgttattggagagcttatgcggtgggggatgtggagaaaatg
gcactggtgaaactagccaagctgcatgaacagctgaatgaatcagaacaggctgctcag
tgctacatcaaatatatccaggatatctattcctgtggggagatagtggagcacctggag
gtgagcactgccttccgctacctagcccaatattacttcaagtgtaagctctgggatgaa
gcctcggcctgtgctcagaaatgctgtgcattcaatgatacaagagaagaagggaaggcc
ttgctgcgacagattttacagctacgcaaccaaggagaaacctcctccacagagattgct
gctcccttcttcctccctgcatcgctgtcatccaacaacacgcccacacggagagtgtcc
ccactcaacctgtcttcagttactccatga

DBGET integrated database retrieval system