KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457599
Entry
102457599         CDS       T02980                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04060  Cytokine-cytokine receptor interaction
pss04068  FoxO signaling pathway
pss04144  Endocytosis
pss04218  Cellular senescence
pss04350  TGF-beta signaling pathway
pss04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102457599
   04350 TGF-beta signaling pathway
    102457599
   04068 FoxO signaling pathway
    102457599
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102457599
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102457599
  09143 Cell growth and death
   04218 Cellular senescence
    102457599
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102457599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102457599
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102457599
Protein kinases [BR:pss01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102457599
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 102457599
NCBI-ProteinID: XP_006137718
Ensembl: ENSPSIG00000003577
LinkDB
Position
Unknown
AA seq 578 aa
MRASPRESQAELIRILGSHRWQTKPKDSTRSAWARRNLKTNLCKWCDSTSPACEEKVCYS
NCNLNSYCENPYEICVAIWKQENDSIKITTLCHNPQLPVENVMVPNYNTSRCIMTHQSSE
EGIFYICGCVDEQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLMAVMITVTFYL
CRTQKRRKRAKDWGQKHPQPQALPEPGKAAEDDEKLSVMTDDRHSRMSLTCANSINHNTE
LLPIELDEVVGKGQFAKVWRAKLNHTTSGQYETVAVKIFPCEEYSSWKNESQIFTDASLK
HESILQFLTAEDRGSGPRKEYWLITAYHSRGNLKDYLSRHILSWMDLQKMASSLVNGVAH
LHSDYTACGRPKIPIAHRDIKSTNILVKSEWECVICDFGIALRLDPSLTADDFANSGQVG
TARYMAPEVLESRVNLEDLESFKQMDVYSMALVLWEMASRCEAVGEVKSYELPFGSKVQE
QPCVDTMRDIVLHGRGRPEIPCNWLVHQGMHFLCDTITECWDHDPEARLTAHCVAERFNL
MAQTDCDDILNNNTDNEGRKTAHPSGEHQTSDGNRNIQ
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgcgtgcctcaccaagagaaagccaagctgagctcatacgtattcttggatctcaccga
tggcaaactaagcccaaggattccacacgttctgcctgggcacgaagaaatctgaagacc
aacttgtgtaaatggtgtgactccacctccccagcgtgcgaggaaaaggtgtgctacagc
aactgtaatttgaattcctactgtgagaacccatatgaaatctgtgtggccatctggaaa
caagagaatgacagcattaagatcaccactctctgccacaacccacagctcccagtagaa
aatgtaatggtcccaaattacaacacctcacggtgcatcatgacccatcagtctagtgag
gaaggaatattttacatctgtggttgtgtggatgaacaggaatgcaacgataaacttata
tttgaaaaccacaccaatggctactccatgctgcagagcaaagaggtcattcctgtagca
gccataagtctgcttccccctctgctcatggctgtcatgataacggtgacattttacctc
tgccgcacccagaaacggagaaagagagccaaggactggggccagaagcacccacagccc
caggctttgcccgagccagggaaagctgctgaggatgatgagaagttatctgtgatgacc
gacgaccgtcactcccgcatgagcttgacctgtgccaacagtatcaaccacaacaccgag
ctgttacccattgagctggacgaggtagtggggaaaggtcagtttgccaaggtctggagg
gcaaagctgaaccacaccacttcggggcaatacgagaccgtagctgttaagattttccca
tgtgaggaatattcctcttggaaaaatgaaagccagatctttacagatgccagcctcaag
catgagagcatcctgcagttcctcacagcagaggacaggggatctgggccacggaaggaa
tactggctcatcactgcctaccacagcagggggaacctgaaggactatctgtcccggcac
attctgagctggatggacttacaaaaaatggccagctctctggtgaacggcgtggctcac
ctgcacagcgactacactgcctgcggcaggccaaagatccccatcgctcaccgggatatc
aaaagcaccaacatcctggtgaagagtgagtgggagtgtgtgatctgtgatttcggcatt
gctctaaggctagacccttccttaacagcagatgactttgctaacagtgggcaggtcggc
actgccaggtatatggctcctgaggttctagagtctagagtgaatctggaagacctggag
tccttcaaacaaatggatgtctactccatggccttggttttatgggaaatggcctccagg
tgcgaggctgtaggagaagtaaagagttatgagctaccatttggatcgaaagtccaagag
caaccctgtgtggataccatgagagacattgtgctgcatggcagagggcgcccagagata
ccttgcaactggctggtgcatcagggaatgcactttctgtgtgacaccatcacggagtgc
tgggaccatgatcccgaggctcgccttacagcccactgcgtggcagagcgattcaatctg
atggcacaaacggactgtgatgacatcctcaacaacaatacagacaatgaaggaaggaaa
acagcccacccaagcggagaacatcaaactagtgacgggaatagaaatatccagtga

DBGET integrated database retrieval system