KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457804
Entry
102457804         CDS       T02980                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04137  Mitophagy - animal
pss04210  Apoptosis
pss04218  Cellular senescence
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04623  Cytosolic DNA-sensing pathway
pss04625  C-type lectin receptor signaling pathway
pss04920  Adipocytokine signaling pathway
pss05132  Salmonella infection
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102457804 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102457804 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102457804 (RELA)
   04218 Cellular senescence
    102457804 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102457804 (RELA)
   04621 NOD-like receptor signaling pathway
    102457804 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102457804 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102457804 (RELA)
   04625 C-type lectin receptor signaling pathway
    102457804 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102457804 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102457804 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102457804 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102457804 (RELA)
Transcription factors [BR:pss03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102457804 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102457804
NCBI-ProteinID: XP_006129748
Ensembl: ENSPSIG00000002944
LinkDB
Position
Unknown
AA seq 565 aa
MAEMEDMLPFVLLQQNWALQEPPPSSNPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERS
TDTTKTHPTIKINNYTGPGKVRISLVTKDAPHRPHPHELVGKDCKDGYYEAELSPERNIH
SFQNLGIQCVKKRELDEAVAQRIRTNNNPFNVPLDDQKGDYDLNAVRLCFQVWVQDPVGT
GHLVPLPLVVSQPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVRFF
KDSWEAKGSFSQADVHRQVAIVFKTPPYQDQALREPVTVQMQLRRPSDKEVSEAMEFRYL
PDEGDFHRIEEKRKRTRDTFKNFVQKTPFAAVVVPEARSPRRIAVPSRTAPVPKPTFSLP
SMSGLPGMAGAMGQLPPIQKPQATAQHTSLPFTGPSQAPPAPQLRFSTVNLEQFSSLGIS
SRAQPPPPVPETEPSFDALFQLPFDSGSDSATMELGALLDDTTYASLESINTNDFRQLLS
QGSSMEGADGHNMLLTYPDSITRLMSSQRGVVSGTGEESQGDGGGGGGSGANSFINGVLG
TLPEESLTSMGDLDFSALLSQFSSS
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggcagaaatggaagacatgctgccttttgtcttactccagcagaactgggcactccag
gagccccctcccagcagcaatccttatgtggagatcatcgaacagcccaagcaacgtggc
atgcgcttccgctacaagtgtgaggggcgttctgccggcagcatccccggggagcgcagc
accgacaccaccaagacacaccccaccatcaagatcaataattacacaggtcctgggaag
gttcgcatctcactggtgaccaaagatgctccccaccgaccccaccctcatgagctggtg
ggcaaggactgcaaggatggctactatgaggctgaactgtcacctgagcgcaacatccac
agcttccagaacctgggcatccagtgtgtgaagaagcgggagctggatgaggcagtggca
cagcgcatccgcaccaacaacaaccccttcaatgtgcccttggacgaccagaagggggac
tatgacctgaacgccgtgcggctttgcttccaggtgtgggtgcaggaccctgtgggtact
ggacaccttgtgccacttccccttgtggtgtcacagccgatctacgacaaccgtgccccc
aacacagctgagctgaagatctgccgggtcaatcgcaactcagggagctgcctgggggga
gacgagatcttcctgctttgtgataaagtgcagaaagaggacattgaagtccggttcttc
aaggactcatgggaagccaagggctccttctcgcaagcagatgtgcaccggcaggtcgcc
atcgtgttcaaaacccccccctatcaggaccaggcactcagggagccggtgacggtccag
atgcagcttcggcgcccatctgacaaggaggtcagcgaggccatggagttccgctacctg
ccagatgaaggtgacttccatcgcatcgaggagaagcgcaagcgcacacgggacaccttc
aagaactttgtacagaaaacacctttcgcagcagtggtagttccagaggcacgctcacca
cgtcggatcgctgtccctagccgcacagctcctgttcccaaacccactttcagcctaccc
agcatgagcggtctccccggaatggcaggggccatggggcagctgccaccaatccagaaa
ccgcaggccacggcccagcacacctctttaccttttactgggcccagccaagctcctccc
gccccccagctgagattcagtacagtcaacctggagcagttctccagcctgggcatctca
agccgggcccagcccccacctcctgttcctgagactgagcccagctttgatgccttgttc
cagctgccttttgacagtgggagcgactccgctaccatggagctgggagccctgttggat
gacaccacctacgccagcctagagtccatcaacactaatgacttccggcagctgctgagc
caggggtcatccatggagggggctgatgggcacaacatgcttctgacctatcccgactca
atcacccgcctgatgagcagccagcgtggtgtggtgagtgggacaggggaagagtcacaa
ggcgacggtggaggtggggggggcagcggtgccaacagcttcatcaacggggtcctaggc
accctccctgaagagagcctcacctccatgggagatctggacttcagtgccttgctcagc
cagttcagctcctcctag

DBGET integrated database retrieval system