KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457993
Entry
102457993         CDS       T02980                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04068  FoxO signaling pathway
pss04110  Cell cycle
pss04115  p53 signaling pathway
pss04218  Cellular senescence
pss04310  Wnt signaling pathway
pss04340  Hedgehog signaling pathway
pss04371  Apelin signaling pathway
pss04510  Focal adhesion
pss04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102457993 (CCND1)
   04340 Hedgehog signaling pathway
    102457993 (CCND1)
   04371 Apelin signaling pathway
    102457993 (CCND1)
   04068 FoxO signaling pathway
    102457993 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102457993 (CCND1)
   04115 p53 signaling pathway
    102457993 (CCND1)
   04218 Cellular senescence
    102457993 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102457993 (CCND1)
   04530 Tight junction
    102457993 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102457993
NCBI-ProteinID: XP_006111531
Ensembl: ENSPSIG00000010300
UniProt: K7FTY5
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDTNLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELFLVNKLKWNLAAMTPHDFIEHFLTKMPVAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNNHTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgttgtgaagtggagaccatcagaagagcctatctagatacc
aacctcctcaatgacagggttctgcagacaatgctgaaagcagaggagacctgctcgccc
tctgtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaaatgtgaagaggaggttttccccttg
gctatgaattatttggacagatttttatcgtttgaacccctcaagaaaagccgattgcaa
ctcctgggagctacctgcatgtttgtggcgtcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttacaccgataactctattagacccgacgagttactgcaaatg
gagctgtttctggtgaataagctgaaatggaatctggctgcaatgacccctcatgatttc
attgaacatttccttactaaaatgcctgtggctgaggacaccaagcaaatcatccgtaaa
catgcccagacttttgtggctctgtgcgctacagacgtcaaatttatttcaaacccacct
tccatgatcgcagctgggagcgtggtagcagctgtgcaaggccttcacctgggaaacaat
cacactttcctctcctatcaatgtctgacacatttcctatcacaagttatcaaatgtgac
ccggattgtttacgagcttgccaagaacagattgaatccctcctcgaatccagtctacgc
caggcacagcaacacaacatatcttcagaaacaaagactgttgaggatgaagcagacctt
tcctgcacacccaccgatgtccgagacgtaaacatttaa

DBGET integrated database retrieval system