KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102458471Help
Entry
102458471         CDS       T02980                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase isoform X1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00010  Glycolysis / Gluconeogenesis
pss00053  Ascorbate and aldarate metabolism
pss00071  Fatty acid degradation
pss00260  Glycine, serine and threonine metabolism
pss00280  Valine, leucine and isoleucine degradation
pss00310  Lysine degradation
pss00330  Arginine and proline metabolism
pss00340  Histidine metabolism
pss00380  Tryptophan metabolism
pss00410  beta-Alanine metabolism
pss00561  Glycerolipid metabolism
pss00620  Pyruvate metabolism
pss01100  Metabolic pathways
Module
pss_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
pss_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102458471 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102458471 (ALDH7A1)
   00620 Pyruvate metabolism
    102458471 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102458471 (ALDH7A1)
   00561 Glycerolipid metabolism
    102458471 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102458471 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102458471 (ALDH7A1)
   00310 Lysine degradation
    102458471 (ALDH7A1)
   00330 Arginine and proline metabolism
    102458471 (ALDH7A1)
   00340 Histidine metabolism
    102458471 (ALDH7A1)
   00380 Tryptophan metabolism
    102458471 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102458471 (ALDH7A1)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102458471 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     102458471 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     102458471 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA TarH DUF1487
Motif
Other DBs
NCBI-GeneID: 102458471
NCBI-ProteinID: XP_006130177
Ensembl: ENSPSIG00000008652
UniProt: K7FP43
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MLQLSFALTRHVLLRKKILASCKRPAVFMSTLLINQPQYAWLKDLGLKEENEGVYNGKWG
GRGEIVTTYCPANNEPIARVQQANLEDYEETIKKAKEAWKTWADVPAPKRGEIVRQIGDA
LRQKIQVLGSLVSLEMGKILVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLED
NKMPGAICSLICGGADIGTTMAKDERVDLLSFTGSTKVGKQVALMVQERFGRSLLELGGN
NALVVFEDADLNLVIPSALFAAVGTAGQRCTTARRLLLHESIHDEVVEKLSKAYAQIRIG
DPWDSNTLYGPLHTKQAVTMFLHAVEQAKQQGGSVVYGGKALNRSGNYVEPTIVTGLPHD
ASIVHTETFAPILYVLKFKTEEEAFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGV
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagctaagctttgctctgaccagacacgttttgctgaggaagaaaattttagca
tcttgtaagaggcctgctgtattcatgtctactttgctgatcaaccagcctcagtatgcg
tggttgaaagacctgggactgaaagaagaaaatgaaggagtgtataatgggaaatgggga
ggaagaggagagattgtgacaacgtattgcccagctaacaatgagccaattgcaagggtg
caacaggccaacttggaggattacgaagaaacaataaagaaagctaaagaggcatggaaa
acatgggcagatgttcctgcacctaaacgtggagaaatagtgagacaaattggtgatgcc
ttaagacagaaaatccaagttctgggaagcttggtctcattagagatgggaaaaattctt
gtcgagggtgttggcgaagttcaggaatatgttgatgtctgtgactatgctgttggttta
tcccgaatgattggtggacctgtcttgccttcagaaagacctggacatgcccttatagaa
cagtggaatcctgtgggattggtaggaattatcactgcatttaacttccctgtagcagtg
tacggttggaataatgcaattgcaatgatctgtgggaatgcttgcctttggaaaggtgct
cctacaacatccctcattagcgtagctgttaccaagataatagccaaagttttggaggat
aacaaaatgcctggtgcaatctgctccctgatatgtggtggtgcagatattggcaccaca
atggcaaaggatgagagggtggaccttctgtctttcactggcagcactaaggtgggcaag
caagtagcacttatggttcaggagagatttggacgcagtttgttagagcttggtggaaac
aacgctcttgttgtgtttgaagatgcagatcttaacctagtgatcccctctgctttattt
gctgctgtggggacagcaggccagagatgcacaactgccagaaggctgctcttgcatgaa
agcatccatgatgaggtggtagagaaactttctaaggcctacgcacagattcgcatcggc
gacccatgggactccaacactctgtatgggcctctccacactaaacaagcagtgacgatg
ttccttcatgcagtggaacaagccaaacagcagggtggctctgtggtctatggcgggaag
gctctgaatcgctctggcaactacgttgagccaacaattgtgactggccttccccatgat
gcatccatcgtgcacactgagacatttgcccccattctctatgtgctgaaattcaagaca
gaagaagaggcctttgcttggaataatgaagtaaaacaaggtctctctagcagcatcttc
accaaggatttgggcaggattttccgctggcttgggcctaagggatcagactgtggtgtt
gtaaatgtcaacattccaaccagtggggctgaaattggaggtgcttttggtggtgaaaag
cacactggtggtggaagagaatctggtagtgattcatggaaactgtacatgagaaggtcc
acttgtacaatcaactacagtaaggatttgcctttggctcaaggaatcaagtttcaataa

DBGET integrated database retrieval system