KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459102Help
Entry
102459102         CDS       T02980                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00590  Arachidonic acid metabolism
pss01100  Metabolic pathways
pss04370  VEGF signaling pathway
pss04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102459102 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102459102 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102459102 (PTGS2)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102459102 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102459102
NCBI-ProteinID: XP_006110924
Ensembl: ENSPSIG00000009768
UniProt: K7FSJ1
LinkDB All DBs
Position
Unknown
AA seq 658 aa AA seqDB search
MQSSERWPQNRSLSTGSSSSNSGSFSSPGSDRPRQRQHLTSSRRATPACEEPRAMIVSCA
LVLALLRVGQAANPCCSNPCQNRGECMTIGFDRYECDCTRTGFYGENCTTPEFLTWLKLT
LKPTPNTVHYILTHFKGVWNIINSIPFFRDSIMKYVLTSRSHLIDSPPTYNSQYHYKNWE
AYSNLSFYTRALPPVSPDCPTPMGVKGKKELPDSTMVVEKFLLRQKFIPDPQGSNVMFTF
FAQHFTHQYFKTDHRRGPAFTKALGHGVDLSHIYGETLERQLKLRLLKDGKLKFQMINGE
MYPPTVKDTQAEMIYPPHIPEHLRFSVGQEVFGLVPGLMMYATIWLREHNRVCDILKQVH
PEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAE
FNTLYHWHPLLPDSFHVHDQEYTFEQFLYNNSIMVEHGLSHMVKSFSKQIAGRVAGGKNV
PFAVKKVAKASIDQSRQMRYQSLNEYRKRFLLKPFKSFEELTGEKEMAAELEELYGDIDA
MELYPGLLVERPRPGAIFGETMVELGAPFSLKGLMGNAICSPQYWKPSTFGGKVGFEIIN
TASLQKLICNNVKGCPITAFHVLNSEATEKATINISSSSSTIEDINPTLLMKERSAEL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcagcgagcgctggccgcagaacagatccttgagcacgggcagcagcagcagc
aactccggctccttctcctccccgggaagtgaccggccccgccagcgccagcacctgacc
agctctcggcgtgcgactcccgcctgcgaagaaccgcgggctatgattgtgtcctgcgcg
ctagtcctggcgctcctgcgcgtcggccaagcagctaatccttgctgttcaaacccatgt
cagaacagaggagagtgtatgacgataggttttgaccgatatgaatgtgactgtacaagg
acaggattttatggggaaaattgtactacaccggaattcttgacctggttgaaactgaca
ttgaaacctactccaaacactgtccactacatcctcactcatttcaaaggcgtctggaat
ataataaatagcattcccttcttccgtgattccatcatgaaatatgtattgacatcaagg
tcacatttgattgacagtccaccaacatacaacagccagtatcattacaaaaactgggaa
gcctattccaacctttccttctacactagagcccttccaccagtgtcaccagattgccca
acacccatgggtgttaaaggtaagaaggagctcccagattccacaatggttgtggagaaa
tttctgctgagacaaaaatttattcccgacccacaaggctcaaatgttatgttcacgttt
tttgctcaacatttcacccaccagtactttaagacagatcaccgcagagggccagccttc
accaaagctcttggccatggggttgacttgagccacatctacggagagactttggagaga
cagcttaagttgcggctacttaaggatggaaagctaaagtttcagatgattaatggagaa
atgtaccctcccactgtgaaggacacacaagcagaaatgatctaccctcctcatattcct
gagcacctgcgattttctgtaggccaggaggtgtttggtttggtcccaggtttaatgatg
tatgccacaatatggctcagagagcataaccgagtctgtgacatccttaagcaggtgcat
ccagagtgggatgatgagcagctgttccaaactaccagactcatattgataggagagacc
atcaagattgtcattgaagactatgtgcagcacttgagtggctaccacttcaagctgaag
tttgatcctgaacttctgtttaaccaacaatttcaatatcagaatcgaattgcagctgaa
ttcaacacactgtaccactggcacccactcctccctgacagctttcacgtccatgaccag
gagtacactttcgagcagtttctctacaacaactccatcatggtggaacatggcctttct
cacatggtgaaatccttctccaagcaaattgctggcagggttgctgggggtaagaacgtt
ccttttgcagtaaagaaagtagccaaggcttcaattgaccaaagcaggcagatgagatac
caatccttgaatgagtaccgaaaacgcttcctactgaaacctttcaagtcatttgaggaa
cttacaggagaaaaagaaatggcagctgaattagaagagctttatggagacattgatgct
atggagctgtaccctggccttctagtagagaggcctcgtcctggtgccatttttggtgag
accatggtggaacttggcgcaccattctctttgaaaggccttatgggaaatgctatttgt
tctcctcagtactggaagcctagcacctttggtggaaaagtgggctttgaaataatcaat
actgcctcgctacaaaagctcatctgcaataatgtgaagggttgtcccatcactgccttc
catgtcctaaactctgaggccacagaaaaggccaccattaatatcagttcctcaagctcc
acaatagaggatatcaaccccacgttattaatgaaagagagatccgctgaactgtag

DBGET integrated database retrieval system