KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459445
Entry
102459445         CDS       T02980                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102459445 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pss04052]
    102459445 (EPO)
Cytokines and growth factors [BR:pss04052]
 Cytokines
  CSF and other factors
   102459445 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102459445
NCBI-ProteinID: XP_006114728
LinkDB
Position
Unknown
AA seq 178 aa
MGRSGLCALLLLLLELAALTHPSPLHPICDARVMEKFIKEARDTENAMEGCANSCNFSEV
LTVPDTKVNFNKWKKMDRQRQAAEVWEGQALLSAAVLRARDLVADPSLSQQLGRTYSNLR
SVGQILRSHNAQMEPALPSAPPPTLSVRTLAKLLSIHSNFLRGRVKLFLTDACRPEAG
NT seq 537 nt   +upstreamnt  +downstreamnt
atggggagatctgggctctgtgctttgctgttgttactgttggaactcgctgcactcact
cacccctctccattgcaccccatttgcgacgcacgagtcatggagaaattcatcaaggaa
gccagagacactgaaaacgccatggaaggttgtgcaaattcttgcaacttctcagaagtt
ctcacagtgcctgacacaaaagttaattttaacaagtggaagaaaatggacaggcagagg
caggcagctgaggtgtgggagggacaggctctcctctcagctgctgtgctccgagcccgg
gacctagtggctgatccctccctgagccagcagctcggccgcacctacagcaacctgcgc
agcgtcggtcagatcctgcgcagccacaatgcccagatggagccagccctgccctctgca
ccaccccccaccctcagcgtccggactttagccaagctgctcagcattcactccaacttt
ctgcggggccgggttaagctctttctgacggacgcctgtcggcccgaggctgggtga

DBGET integrated database retrieval system