KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459971Help
Entry
102459971         CDS       T02980                                 

Gene name
MAP3K9
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102459971 (MAP3K9)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102459971 (MAP3K9)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: TKL group
  MLK family
   102459971 (MAP3K9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal DUF1476
Motif
Other DBs
NCBI-GeneID: 102459971
NCBI-ProteinID: XP_025044083
Ensembl: ENSPSIG00000015550
LinkDB All DBs
Position
Unknown
AA seq 915 aa AA seqDB search
MLKHPNIIALRGVCLKEPTLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIARGMNYL
HDEAIVPIIHRDLKSSNILLLEKVENGDLSNKILKITDFGLAREWHKTTKMSAAGTYAWM
APEVIRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPE
PFAKLMEVAFRSQPNQADSSCSYELSLQEKTKVDEDCWNSDPHSRPSFANILDQLTTIEE
SGFFEMPKDSFHSLQEDWKLEIQEMFDQLRAKEKELRTWEEELTRAALQQKNHEELLRRR
EQELAEREIDILERELNIIIHQLCQEKPRVKKRMGKFKKNRLKLKDGNHISLPSDFQHKF
TVQASPTMDKRKSLISSCSSPPASPTIIPRLRAIQLTPGESSKTWGCNSLLQKEEGEEEE
KRNQKKKGRTWGPSSLCQKELAAGEDGLTSLVEGHKQWSSSAPNLGKVQRTIPALPGFTS
LIEMEDEDRECLNGDKVYHSPGRTPSYLCIPFQKSGELDGPPSDANEESTPMNSATSTPQ
LTPTNSLKRSGSQHKRWEVALLGCGAVLAAAGLGFDLLEAGKCQLLTQDELEPPKEEKKK
RDSIFQRTGRSRRSTSPPSRKLFKKEDAMLMLGEPSTSLTLLSLSSISECNSTRSLLRSD
SDEIVVYEMPVSPVTVKAPLPVVSNPLVNVRIERFKQDPNQSLTPTHVTLSSRAQQRGHR
RTPSDGAIKVAGLVANGCSPNRCPSSNCLTGALGTGVLKTPSPSRDPNEVPRLPDPNLVF
PPTPRRWNAQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSQARGESSANSSSTDT
PSNLDSCFASSSSTVEERPGLPALLPFQVGVPVEEQMLLDLDVEGQSQDSTVPLCRTELK
TTKPAAYELKQEFWS
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcatcccaacatcattgccctcaggggagtgtgtctgaaagaacctaccctc
tgcctgatcatggagtttgcccgtggagggtcactaaatagagtgctgtcaggtaaaagg
attcctccagacattctagtgaactgggctgtccagattgccaggggaatgaattacctg
catgacgaagcgattgttcctattattcaccgtgatctcaaatccagcaacatattgtta
cttgaaaaggtggaaaatggagacctgagcaacaagatattgaagatcacggatttcggc
ttggccagagaatggcataaaaccaccaaaatgagtgcagctggaacatatgcctggatg
gctcctgaggtcatccgctcctccatgttctccaaaggcagcgatgtgtggagttatggt
gtattgctttgggaactattaactggggaggtaccattccgaggaattgatggtttagca
gtagcatatggagttgccatgaataaacttgcccttccaatcccgtccacgtgcccagaa
ccttttgccaaactcatggaagtagcatttagaagccaaccaaatcaggctgacagttcc
tgctcctatgagcttagtctacaagagaagacaaaagtagacgaagactgttggaactct
gacccacactcacgaccatctttcgccaatatcctagaccaactcactaccatcgaggag
tctggcttctttgaaatgccaaaagattccttccactccctgcaggaagactggaagctt
gagatccaggagatgtttgatcagctcagggcaaaagaaaaggagctgcgcacatgggag
gaggagctgacccgtgctgcactccagcagaagaaccacgaggagctgctgcggcggcga
gagcaggagttggcagagcgcgaaatagacatcctagaaagggagctcaatatcatcatc
catcagctatgccaggagaagcctcgggtgaagaaacgcatgggaaagttcaagaagaac
cggcttaagttgaaagatggcaatcacatcagcctgccttcagatttccaacacaaattc
actgtgcaggcatcaccaaccatggataaaagaaaaagcttgatcagtagttgttccagt
cctcctgcaagtcctaccatcattcccagactcagagccatccagttgacacctggtgaa
agcagcaaaacatggggatgtaactcactcctccagaaggaggaaggagaggaggaagag
aagagaaaccagaagaagaaagggcgcacctggggaccaagttctctttgtcaaaaggag
ttagctgcaggagaagatggcctcacatctctggtagagggacacaaacaatggtcatct
agtgctccaaacctagggaaggtccagagaactatacctgccttgccaggattcaccagc
ctaatagagatggaggatgaagaccgtgagtgtcttaatggagacaaagtataccactca
cctggtcgcaccccatcgtacctctgtatcccgtttcagaagagcggagagcttgatggc
ccacccagtgatgccaatgaggagtccactcccatgaattctgcaacaagcacccctcag
ctcacacccaccaatagccttaagcggagcggctcccaacataagaggtgggaggttgcc
ttgcttggctgtggggcagtgctggctgctgcaggcctgggctttgatctgttggaggca
ggcaagtgtcagttgctgacccaggatgagctggaaccacccaaggaggagaagaagaag
cgtgacagtattttccagaggactgggcgctcgcgcagaagcaccagcccaccttcccgg
aagctcttcaaaaaagaagacgccatgttgatgctgggcgagccatccacctcactgact
ctcctctccctgtcttccatttctgaatgtaactccacccgctccctgctgcgctcagac
agcgacgagattgtggtgtatgagatgcctgtcagccctgtgacagttaaggctcccttg
ccagtagttagcaatccactggtcaatgtacgcattgaaaggttcaagcaggatcccaac
caatccctgactcccacacatgtgacactctcttcacgtgcccagcaaagggggcacagg
cggacaccttctgatggggctatcaaagtggctggactggttgccaatgggtgctctccc
aacaggtgtccttccagtaactgtttaactggtgcactgggcacaggtgtattaaaaact
cccagcccaagccgagatccaaatgaggttcctcgcctgccagatcccaaccttgtcttt
cctccaaccccaagacgctggaatgcacagcaggactccacactggaaagacccaaaacc
ttggagttcttgccgaggccacgcccttcagccaatcgacagcgacttgatccctggtgg
tttgtgtcacccagccaagcaaggggtgaatcctctgccaacagctcaagtactgatacc
ccaagcaatctggactcctgctttgctagtagcagcagcactgtagaggagaggccagga
cttccagctctgcttcctttccaggtgggtgttcctgtagaggagcagatgctgttggac
ttagatgttgaggggcagagccaggatagcactgttccgctatgcagaactgaacttaaa
acaaccaaacctgcagcgtatgaactgaaacaagagttctggtcttag

DBGET integrated database retrieval system