KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459990Help
Entry
102459990         CDS       T02980                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00052  Galactose metabolism
pss00500  Starch and sucrose metabolism
pss01100  Metabolic pathways
pss04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102459990 (GAA)
   00500 Starch and sucrose metabolism
    102459990 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102459990 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102459990 (GAA)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102459990 (GAA)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102459990 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102459990
NCBI-ProteinID: XP_006112923
Ensembl: ENSPSIG00000007789
UniProt: K7FKT0
LinkDB All DBs
Position
Unknown
AA seq 916 aa AA seqDB search
MKSYQKLATDLPQPPDAYAEEESIARKPPYHRQLSTWWLCVGLLMVAVLLSGVTLWMLKQ
VPGDQLGQTPPEKCSAVPEPFRFDCYPEWSVVVTKELCESRGCCFIERVQPRGNRSTKPW
CFYPPDFPSYTLESLNQTELGMVGLLRRKVKAYYPRDIERLQLSVEFETDTRLHIKITDS
TSPRYEVPLEVPRATKRAENPIYSLEFSKEPFGLLLRRRASGAVLLNTTVAPLIFADQFL
QISTVLPSIFLYGLGEHRSHFLHSLDWSTLTLWARDVPPMQFYNLYGVHPFYLLMEEGGA
AHGVFLLNSNAMEVVLQPAPALTWRTIGGVLDFYIFLGPDPNMVIQQYHQVIGFPAMPPL
WGLGFHLCRWGYGTSNETWQTVKAMRNYQIPQDAQWNDIDYMEGYRDFTYEPEKFDTLPQ
LVEDLHKHGQHYVMITDPAISSSNPPGSYWPYDEGLRRGIFINTTEGQTLIGQVWPGLTA
FPDFSNPDTSQWWLENLNRFHALVPFDGLWIDMNEPSNFKDGSVHGCPWGEFDNPPYVPA
VLGGSLSSKTTCASAKQRVSVHYNLHNLYGLMEAKATASALIQIRGKRPFVISRSTFPSQ
GRYSGHWLGDNRSKWSDMYWSIPGVLNFNLFGIPLVGADICGFSGTTTEELCTRWTQLGA
FYPFARNHNYLNDKAQDPAAFSSVVRTAMKEVLLTHRAHLQGHTVARPLFFEFPQDEITY
SIDKQFLWGRSLLVTPVLEPGVDSVTGYFPRGVWYDYYTGTSVNSSGESLKMAAPLDHIN
LHVREGAILPTQKPGSTSWVSSRNPLRLIAALSQNASAWGDLFWDDGESLETFEKGAYSY
LVFNVTQNVFTSTVLHANVEATYITVDTLTVYGVRDEPSRVTVNGKENPFSYLDNQVLTV
SHLNLKLSQGFSIRWQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctaccaaaagctggcaacggaccttccccagcctccagatgcctatgccgaa
gaagaaagcattgctaggaagccaccgtaccatcggcagttgtccacttggtggctgtgt
gttggcttgctgatggtggctgttctgttgagtggagtcaccctgtggatgctcaaacag
gtgcctggggaccagcttggacagacccccccagagaaatgcagtgctgttccggagcct
ttccgctttgactgctacccggagtggagcgtggtggtgacaaaagagctgtgtgagagc
agggggtgctgttttattgaacgcgtccagcctagggggaacaggagcaccaagccttgg
tgcttttacccccctgactttcccagctacactttggagagcctgaaccagactgagctg
ggaatggtgggtttgctgaggaggaaggtgaaagcctattatcccagagacattgagaga
ctgcaactgagcgtggagtttgaaacggacactcggttacacatcaagatcactgattcc
accagcccccggtacgaagtccccctggaggttcctcgggcaacgaagagagcagagaat
cccatatacagcctggagttctccaaggagccttttggcctgctgctgaggcgcagagcc
tctggcgccgtgctgttaaacacaaccgtggctcccttgatctttgctgaccagtttctc
cagatttcgaccgtcctcccttccatattcctctacggcctcggggagcatcggagccac
ttcctgcacagcctggactggagcaccctgacgctgtgggcccgggatgtccctcctatg
caattttacaacctttatggagttcacccattttacctgctgatggaggaaggaggagct
gctcatggtgttttcctcctgaatagcaatgcaatggaggtggttctgcagccagcacct
gccttgacctggagaaccattggaggagtcctggatttttacatcttcttgggtcctgat
cccaacatggtcatccagcagtaccaccaggtgataggtttccctgccatgccacctctc
tgggggctggggtttcatctgtgccgctggggctatgggaccagcaatgaaacctggcag
actgtgaaagccatgaggaattatcagataccgcaggatgcgcagtggaacgatattgat
tacatggaagggtaccgggacttcacttacgagcctgagaagtttgacaccctcccgcag
ttggtagaagaccttcacaagcacggccagcactatgtcatgatcacggatccggcgatc
agcagctctaaccctcctggctcttactggccttacgacgaaggcttgaggcgtggaata
ttcataaataccaccgaggggcaaacactgattggacaggtgtggcctggcctcacggct
ttcccggacttctccaacccggacacttctcagtggtggctggagaacctgaaccgtttc
cacgctctcgtcccctttgatgggctttggatcgacatgaacgaaccatccaacttcaag
gacgggtcggtacatggctgtccctggggagaattcgataaccctccctacgtgcctgct
gtgctgggcgggtccctctcgtcaaagaccacgtgtgcctcagcgaagcagagagtctct
gtgcactacaacctgcacaacctctacgggctgatggaagccaaagccacagctagcgcc
ttgatccagatccgagggaaacgcccatttgtgatttctcgctccaccttccccagccag
ggcaggtactcggggcactggcttggtgacaacaggagcaagtggtcggacatgtactgg
tcaatcccaggggtgctgaacttcaatctctttgggatcccgctggttggggcagacatc
tgtgggttctcgggcaccaccacggaggagctgtgcacccgctggacccagctgggggcc
ttctaccccttcgcccgaaaccacaactacctgaatgacaaggcccaggatccggcggcg
ttcagctcggtggtgcggacggccatgaaagaggtgctgctgacccaccgggcgcacctg
cagggccacaccgtggctcgacccttgttctttgagtttccacaggacgagatcacgtac
tcgattgacaagcagttcctgtgggggcggagcctattggtgacacctgtgctggagcct
ggagtggactcggtgactggctacttccccaggggagtgtggtacgactactacacgggc
acctctgtgaacagcagtggggagagcctgaagatggccgctccgctggaccacatcaac
ttgcacgtccgagagggtgccattctccccacccagaaacccgggagcaccagctgggtg
agcagcaggaaccccctacgcctgatcgcggccctgtcccagaacgccagcgcctggggg
gacctcttctgggacgatggcgagagcctggaaacctttgagaagggcgcctactcctac
ctggtgttcaacgtcacgcagaacgtcttcacctccactgtccttcacgccaacgtggaa
gccacctacatcactgtggatacactgacagtctatggggtccgggacgagcccagcagg
gtcactgtcaatggcaaagagaatcccttctcctatctggacaaccaggttctcactgtg
agccacctcaacctcaagctcagccaaggattctccatccgctggcagtga

DBGET integrated database retrieval system