KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102460388
Entry
102460388         CDS       T02980                                 

Gene name
STAT3
Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04068  FoxO signaling pathway
pss04217  Necroptosis
pss04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102460388 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102460388 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102460388 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102460388 (STAT3)
Transcription factors [BR:pss03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102460388 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2
Other DBs
NCBI-GeneID: 102460388
NCBI-ProteinID: XP_014437301
Ensembl: ENSPSIG00000015868
LinkDB
Position
Unknown
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRLKAQKPEERFQFIQSRYLEKPMEIARIVARCLWEES
RLLQTAATAAQQGGQAAHPPGASALSXPRLLGLQDLEQKMKVVENLQDDFDFNYKTLKSQ
GDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLADEELAD
WKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHR
PMLEERIVELFRNLMTSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQL
KIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLVSCGAPGIPXT
ASLSSQASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYN
MLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSG
CQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTK
PPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIMD
ATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEATDSGTAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNSEGAEANAGGQFESLTFDMELTPECTASPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcgcagtggaatcagctgcagcaactggacacgcggtacctggagcagctgcatcag
ctctacagtgacagcttccccatggagctcaggcagttcctggccccctggattgagagc
caggactgggcgtacgcggccagcaaggagtcccacgccacactggtgttccacaacctg
ctgggagagatcgatcagcaatacagccggttcctgcaggaatccaatgtcctctaccag
cataacttgcgcctaaaggctcaaaaaccagaagaaagattccaatttatacagagcagg
tacctggaaaagcccatggagatcgcccggatcgtggcccggtgcctctgggaagaatct
cgcctgctccagacggccgcgaccgcagcccagcaaggcgggcaggcagcccaccccccg
ggagcctctgccctgagctgaccccggctcctgggcttgcaggatctggagcaaaagatg
aaagtggtggagaatctccaggacgacttcgacttcaactacaagacgctgaaaagccaa
ggagatatgcaggacctgaatggaaacaatcagtccgtgacgcggcagaagatgcagcag
ctggagcagatgctgacggcgctggaccagatgcgcagggggatcgtgagcgagctggcc
gggctgctgtcggccatggagtacgtgcagaagacgctggcggacgaggagctggcggac
tggaagagaaggcagcagatcgcgtgtatcgggggccctcccaacatctgcctagaccgc
ctggaaaattggatcacgtccctcgcagagtcccagcttcagacgcggcagcagatcaag
aagctggaggagctgcagcagaaagtctcctacaaaggggacccgattgtccagcaccgg
cccatgctggaggagaggatcgtggagctgttcaggaatctcatgacgagcgccttcgtg
gtggagcggcagccctgcatgcccatgcacccggatcggcccctggtcatcaaaaccggc
gtgcagttcaccaccaaagtcaggctactcgtcaaatttcctgagctcaactatcagctg
aagattaaagtctgcatcgacaaggactcgggggacgttgccgcgctccgggggtcccgg
aagtttaacatcttgggcacgaacaccaaggttatgaacatggaggagtcgaacaacggc
agcctgtcagcagagttcaagcatctggtaagttgcggggcccccggcatcccctgaacg
gcctccctgtcctcccaggcctccctgattgtcacggaggagctgcacctcatcaccttc
gagaccgaggtctatcaccagggcctgaagatcgacttggagacccactcgttgcctgtc
gtggtcatctccaacatctgccagatgcccaacgcctgggcctccatcctgtggtacaac
atgctgacgaacaaccccaagaacgtgaacttcttcaccaagcccccgatcggcacgtgg
gaccaggtggccgaggtgctgagctggcagttctcctccaccaccaagcgggggctcagc
atcgagcagctgaccacgctggcggagaagctcctagggcccggcgtcaactactccggc
tgccagatcacctgggccaagttctgcaaggaaaacatggccggcaaagggttttccttc
tgggtctggctggacaacatcatcgacctggtgaagaaatacatcctggcgctgtggaat
gaggggtacatcatgggcttcatcagcaaggagcgggagcgcgccatcctgagcaccaag
ccgcccggcaccttcctgctgcgcttcagcgagagcagcaaggaggggggtatcaccttc
acctgggtggagaaggacatcagcgggaaaacccagatccagtccgtggagccgtacacc
aagcagcaactcaacagcatgtccttcgcggaaatcatcatgggctacaagatcatggat
gccaccaacatcctggtctcgcccctggtctacctgtaccccgacatccctaaggaggaa
gcctttggcaaatactgccgccccgagagccaggagcaccccgaagctacggactcaggc
accgcgccgtacctgaagaccaagttcatctgcgtcaccccaacgacctgcagcaacacc
atcgacctgcccatgtccccgcgcacactggactcgctcatgcagtttggcaataacagc
gagggagccgaggccaacgccggaggccagtttgagtctctgaccttcgacatggagctg
actccggagtgcaccgcctcgcccatgtga

DBGET integrated database retrieval system