KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102460414Help
Entry
102460414         CDS       T02980                                 

Gene name
PARK7
Definition
(RefSeq) protein/nucleic acid deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pss01002]
    102460414 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102460414 (PARK7)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     102460414 (PARK7)
Peptidases [BR:pss01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   102460414 (PARK7)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102460414 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 102460414
NCBI-ProteinID: XP_006118028
Ensembl: ENSPSIG00000013522
UniProt: K7G4K8
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPTDIMRRAGIKVTVAGLTGRDPVQCSRDVFICPDASLED
ARKEGPYDVVVLPGGNLGAQNLSESPAVKDILVDQETRKGLIAAICAGPTALLAHGIGFG
RKVTTHPLAKDKMMNGDHYMYSDSRVERDGNFLTSRGPGTSFEFGLAIVEILMGKEVADQ
VKAPLLLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaaagagctttagtgattctggctaagggagcagaggagatggaaacggtt
atccccactgacataatgagaagggcaggaatcaaggtgactgttgcaggtttaacagga
agagatccagtgcagtgtagccgagatgtcttcatttgtcctgatgccagtctagaagat
gccaggaaagaggggccttatgatgttgtggtcctgccaggtggaaacctaggagctcaa
aatttgtcagagtctcctgctgtgaaagacattttggtggaccaggagaccagaaaaggc
ctgattgctgctatttgtgcaggtcctactgccttgctggcccatgggatagggtttggg
aggaaagttacaacacaccctttggccaaagataaaatgatgaatggagaccattacatg
tactctgacagccgtgtggaaagggacgggaactttctcaccagccgtggccctggcacc
agctttgagtttggcctggctattgttgaaatactgatggggaaggaggtggctgatcaa
gtgaaggctcctcttctattgaaagattag

DBGET integrated database retrieval system