KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102460423Help
Entry
102460423         CDS       T02980                                 

Definition
(RefSeq) pancreatic alpha-amylase isoform X1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00500  Starch and sucrose metabolism
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102460423
Enzymes [BR:pss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102460423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 102460423
NCBI-ProteinID: XP_006119859
LinkDB All DBs
Position
Unknown
AA seq 549 aa AA seqDB search
MLKIVGLFKSVICTMYFTLLHEYKNPGRRTQAIIKRTMKAFLLLAVISFCWAQYNPNTKP
GRTSIVHLFEWCWADIALECERYLAPNGFGGVQISPPNENIIITNPWRPWWERYQPISYN
LCTRSGYEHEFKDMVTRCNNVGVHVYVDAVINHMCGSGAGSGNSSTCGSYFNSGTRDFPA
VPYSAWDFNDGKCKTGSGGIENYHDVTQVRDCQLVSLLDLALEKDYVRSKIAEYMNNLID
IGVAGFRIDASKHMWPGDMTAILDKLKNLTEQWFAEGSRPFIYQEVIDLGEEPIKSSEYF
GNGRVTEFKYGAKLGTVLRKWNGEKMAYLKNWGEGWGFMPSDRALVFVDNHDTQRGHGAG
GASVLTFWDSRLYKMALGFMLAHPYGLTRVMSSYRWPRFFQNGKDINDWVGPPSYEDGSI
KPVTINPDTTCGNDWICEHRWRQIKNMVIFRNVVDDQPFTNWWDNDSNQVAFGRGNRGFI
IFNNDNWYLNVNLQTGLPNGTYCDVISGQKEDDHCTGLHVEVAGDGRANFQISNHAEDPF
IAIHVDATL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatagttggccttttcaaatctgtaatttgtaccatgtactttaccctcttg
catgagtataaaaatccagggagaagaacacaagctattattaaaagaaccatgaaggcc
tttcttctgctagctgtcatttcattttgctgggcccagtacaacccaaatacaaaacct
gggaggacgtctattgtccacttatttgaatggtgttgggctgacattgctcttgaatgt
gaacggtatttagcacccaatggatttggtggagttcagatatctcctccaaatgaaaat
attataattactaacccatggaggccctggtgggaacgataccagccaatcagctacaat
ctatgtacacgatctggatatgagcatgaatttaaagacatggtgaccagatgcaacaat
gttggagttcatgtttatgtggatgctgtaattaatcacatgtgtggatctggtgctggc
tctggtaatagttctacttgtggaagctatttcaattcagggaccagagattttcctgct
gtgccatactcagcgtgggactttaatgatggtaaatgtaaaactggaagtggaggcatt
gaaaattaccatgatgtgactcaggtccgtgactgtcaacttgtcagtcttctcgatctc
gccctggagaaggactatgtgcgctcaaaaattgcggaatacatgaacaatcttattgat
atcggcgtggcaggcttcagaattgatgcttccaagcacatgtggcctggggacatgaca
gcaattttagacaaactgaaaaatctaactgaacagtggtttgccgaaggatcaagacct
ttcatttaccaggaggtaattgacttgggtgaagagccaatcaagagcagtgaatatttt
ggaaatggccgagtgactgaattcaaatacggtgccaaactgggtacagtactccgcaaa
tggaatggagaaaagatggcctatttaaagaactggggagaaggctggggtttcatgccc
tctgacagagctcttgtctttgtggataatcatgatacccagaggggacatggtgctggg
ggagcttctgttctaaccttctgggattccagattgtacaaaatggcacttggttttatg
cttgcacatccttatggattgacacgtgtaatgtcaagttatcgttggccaagatttttt
cagaatggaaaggacattaatgattgggtgggaccaccaagctatgaggatggatcaatt
aaacctgttacaattaatccggacactacttgtggcaacgactggatctgtgaacacaga
tggcgtcaaataaagaacatggttatcttccgtaatgtggttgatgaccagcctttcaca
aactggtgggacaatgacagcaaccaagtggcttttgggcgtggtaatagaggtttcatc
atctttaataatgacaactggtacttgaatgtaaacttgcaaactggtcttcccaatggc
acttactgtgatgttatttctggtcaaaaggaagacgaccactgtacaggattacacgtg
gaggtagctggtgatggcagggctaacttccagattagtaaccatgctgaggatcctttc
attgcaattcatgttgatgcaactttgtaa

DBGET integrated database retrieval system