KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102461233Help
Entry
102461233         CDS       T02980                                 

Gene name
SUGT1
Definition
(RefSeq) protein SGT1 homolog isoform X1
  KO
K12795  suppressor of G2 allele of SKP1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102461233 (SUGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SGS CS TPR_1 TPR_17 TPR_2 TPR_11 TPR_8 DUF2018 TPR_16
Motif
Other DBs
NCBI-GeneID: 102461233
NCBI-ProteinID: XP_006124434
Ensembl: ENSPSIG00000005655
UniProt: K7FDN3
LinkDB All DBs
Position
Unknown
AA seq 334 aa AA seqDB search
MAAAAALDPARPRFPDEDIEQDPGAAAQKLTVALEQKPDDAEYYCQRAYAHILLQNYWDA
VADAKKSLELNPDNATAFLRKGIGEYHIKNYTSALESFKEGQKLDNVDTTFTIWIQRCEE
TLNTGSQTEMTTQQTTEPSKIKYDWYQTESQVIVTLMIKNAQKDCVHVQFSEKELNALVR
LASGEDCNLKLVLLHSIVPEQSTFKVLSTKIEIKMKKPEAIRWEKLEGQEDSPKLKQNTS
DSQHLYPSSSHYTRNWDKLVIEIKEEEKNEKLEGDAALNKLFQQIYSDGTDEVKRAMNKS
FMESGGTVLSTNWSDVGKRKVEVNPPDDMEWKKF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggccttggacccggcccgtccgcggttcccggacgaagacatcgag
caggacccgggggcggcggcgcagaagctgacagtggccttggaacagaagccagatgat
gcagaatattactgtcaaagagcttatgctcatattcttctacagaattactgggatgct
gttgcagatgcaaagaagtccctagaactcaatcctgataatgccacagcttttctcagg
aaagggataggtgaatatcatatcaaaaactatacttctgctcttgagtccttcaaagaa
ggacagaaattggacaatgtggatactacttttactatttggattcaaagatgcgaagaa
acactaaacacaggatcacagactgaaatgactacacaacagacaactgagccatcaaaa
atcaagtatgactggtaccaaacagaatctcaagtaatcgtgactctcatgatcaagaat
gctcagaaggattgcgtccatgtacaattttcagagaaagagctgaatgcattggtgaga
cttgcatccggagaagactgcaacttaaagcttgttcttctgcattccattgtaccagag
caaagtacatttaaagtgctttcaacaaagattgagataaaaatgaagaagccagaggct
ataagatgggagaagctggaggggcaagaagattctcctaagctaaaacagaatacatca
gactcccaacacctatatccgtcgtcttctcattatacaaggaactgggacaaactggtg
attgaaatcaaagaagaagaaaagaatgaaaaattagagggggatgctgctttaaataaa
ctctttcagcaaatctattcggatggtacagatgaagttaaacgtgccatgaataaatcc
tttatggagtctggagggactgttctgagcacgaactggtctgatgtggggaaaaggaag
gttgaagtaaatcctcctgatgacatggaatggaaaaaattctaa

DBGET integrated database retrieval system