KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102461918Help
Entry
102461918         CDS       T02980                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00010  Glycolysis / Gluconeogenesis
pss00030  Pentose phosphate pathway
pss00051  Fructose and mannose metabolism
pss00052  Galactose metabolism
pss01100  Metabolic pathways
pss01200  Carbon metabolism
pss01230  Biosynthesis of amino acids
pss03018  RNA degradation
Module
pss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102461918 (PFKP)
   00030 Pentose phosphate pathway
    102461918 (PFKP)
   00051 Fructose and mannose metabolism
    102461918 (PFKP)
   00052 Galactose metabolism
    102461918 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102461918 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pss01009]
    102461918 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pss03019]
    102461918 (PFKP)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102461918 (PFKP)
Protein phosphatases and associated proteins [BR:pss01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102461918 (PFKP)
Messenger RNA biogenesis [BR:pss03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102461918 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102461918
NCBI-ProteinID: XP_006111970
LinkDB All DBs
Position
Unknown
AA seq 824 aa AA seqDB search
MNAAVRAVVRMGIYVEAKVYFIYEGYQGMVDGGNNIVEVSWESVSSILQVGGTVIGSARC
KAFRNREGRLKAASNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAQSGKIEEEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEDQMCVKLCENRARKKRLNIIIVAEGAIDC
HNEAITSEKVKDLVVLQLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
DTPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDERKFCEAVRLRGRSFENNLNTYKLLS
HRRPDAELPKTNFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHNMFAVIDGFEGFSRGQI
KEISWGDVGGWTGQGGSLLGTKRTLPAKYLEKIADQMRANNINALMVIGGFEAYLGLLEL
SAAREKYEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDVSLFKCACLLTKHSRKI
MCDLFLSVIEVAKKVDKVVAKEAGSIIVAYESCLQLAEARARFEEFCIPICVLPATISNN
VPGTDFSIGADTALNAIVETLANMGGLAAGADAAYIFEEKFDIRELQANVEHLTEKMKTS
IQRGLVLRNENSNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKI
SAKAVQWISKKLRETYRKGKVFANTDDTVCLLGMRRRNLLFQPVVELKGEADFEHRIPKE
QWWLKLRPLMKILAKYKTSYDVSDSGQLEHVARHSPKEMETGAI
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgcagtacgtgcagtagtgcgtatgggaatctacgtggaagctaaagtatat
tttatttatgagggataccaaggtatggttgatggaggtaacaacattgttgaagtgtca
tgggaaagtgtttcaagcatcttgcaagtgggagggacagttattggtagtgcacgctgc
aaagcatttcgtaatcgggaaggccgtttgaaggcagcgtccaacttgattcagcgtgga
atcactaacctttgtgtgattggtggtgatggtagtttaacaggtgctaatctctttcgt
gaagaatggagtggacttctagaggaactggcacaaagtggcaagattgaagaagaagct
gttaaaaaatatgcttatctcaacattgttgggatggttggatccatagataatgacttc
tgtggcactgatatgacgattggtactgactcggccttgcacagaatcattgaagtcgtg
gatgctattatgaccactgctcaaagccatcaaaggacctttgtcctagaagttatggga
agacactgtgggtatctagctcttgttagtgcattagcttgtggtgcagattgggtattt
attccggaataccccccagaagaaggatgggaggatcagatgtgtgttaagctttgtgag
aaccgtgcacgaaaaaaaaggctgaatattataattgtggcagaaggtgccattgattgt
cataacgaagctatcacttcagaaaaggttaaggatcttgtggttctgcagctgggattt
gacactcgtgttaccattctgggtcatgttcaaagaggaggcactccttcagcctttgat
agaattttggcaagccgtatgggtgtggaagctgtactggcccttctagaggctacacca
gatactcctgcttgtgttgtgtccttgtctgggaaccaggctgtccgtctgcctttaatg
gagtgtgtgcagatgactcaagaagtacagaaagcaatggatgaaagaaagttttgtgag
gctgtgagacttcgtggaaggagctttgaaaacaacctgaacacctacaaattattgtct
cacagaagaccagatgcagaacttccaaagactaattttaatgtggcagttttaaatgta
ggtgccccagcagctgggatgaacgctgctgtccgatctgcagtaagagttggcataact
gaaggtcacaacatgtttgctgttattgatggatttgaaggcttttctagaggccagata
aaggaaatcagctggggagatgttggaggatggactggccaaggagggtcacttcttggc
acaaaacgtaccctccctgcaaaatatttggagaagattgctgaccagatgcgtgctaat
aacatcaacgctcttatggttattggtggatttgaggcctacctgggacttttggaattg
tcagctgcccgtgagaaatatgaggagttctgtgttccaatggttatggttcctgcaact
gtatccaacaatgtaccgggttcagatttcagcattggtgcagatactgctctgaacact
ataactgatgtaagtctgttcaagtgtgcatgcttactaacaaagcattcaagaaaaatc
atgtgtgatctttttctttcagtaatagaggtagctaaaaaagtggataaagtggtagct
aaagaagcagggtccataatagtagcttatgaaagttgtctgcaattagctgaggcacgt
gctcgctttgaggagttttgcattcctatctgtgtgttgccagctactattagcaacaat
gtgccaggcactgactttagcattggtgctgacactgccctgaatgctattgtggagaca
ttagccaatatggggggcctggctgcaggtgcagatgccgcttatatctttgaagagaag
tttgatattcgagagctccaggctaatgtggagcatttgactgaaaagatgaaaaccagc
atccagcgtggtcttgtgctaaggaatgagaacagcaatgagaactacacaactgacttt
atctaccagttatattctgaggaaggaaaaggcgtgtttgactgcagaaagaatgtactg
ggccacatgcagcagggtggagcaccttccccatttgacaggaactttgggacaaaaatc
tctgcaaaagcagtacaatggatctccaagaaactgagagaaacctaccgcaaaggaaaa
gtgtttgccaacactgatgacacagtttgtttgctaggaatgcgcagacgcaatcttctt
ttccaacctgtggttgagcttaagggtgaagcagattttgagcacagaattcccaaggaa
cagtggtggctgaaacttcgacctctgatgaaaattctagccaaatacaagaccagctat
gacgtttcagattcaggtcaactagagcatgtagctaggcacagccccaaagaaatggaa
actggagccatctaa

DBGET integrated database retrieval system