KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102462957Help
Entry
102462957         CDS       T02980                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00350  Tyrosine metabolism
pss01100  Metabolic pathways
Module
pss_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102462957 (GSTZ1)
Enzymes [BR:pss01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     102462957 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 102462957
NCBI-ProteinID: XP_006134871
Ensembl: ENSPSIG00000004669
UniProt: K7FAE2
LinkDB All DBs
Position
Un
AA seq 218 aa AA seqDB search
MSGALVKPVLYSYFRSSCSWRVRIALALKGIAYDQEPVNLLKDGGQQFSTEFQAVNPMQQ
VPALKIDGILLSQSLAIIQYLEETRPNPSLLPQDLKKRAQARMISDHIVSGIQPLQNLSM
LKRVGGEKKLEWAQHYITCGFQALERILQHTAGHYCIGDEVSMADLCLVPQVYNAERFKV
DLTPYPTVTRINKALLELEAFQVSHPCRQPDTPAELRA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtgccttagtgaagccggttctttatagttatttccgaagttcctgctcttgg
agagtgagaatagcactggctctgaagggaattgcctatgatcaggaaccagtgaacctc
ttgaaggatgggggacagcagttttctacagaattccaggcagtgaatccaatgcagcag
gtcccagccctgaaaatcgatggcatcctcctgtctcaatctctagccataattcagtac
ttggaagagacccggcccaaccccagcctgctgcctcaagatctgaagaagagagcccaa
gcccggatgatttcagatcacattgtttctggcattcagcccttgcagaacctgagtatg
ctgaaacgagtgggaggggagaagaagttggaatgggctcaacactatatcacatgtggt
ttccaagctctagagcggatcctgcagcacacagctgggcattactgcattggggatgag
gtttcaatggctgacttgtgtttggtccctcaggtttacaatgctgagagatttaaagtg
gatctgactccataccccaccgtaacaagaatcaataaagcccttctggaattagaggca
ttccaagttagccacccatgccggcagcctgatacccctgcagagctacgagcataa

DBGET integrated database retrieval system