KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102463305
Entry
102463305         CDS       T02980                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00230  Purine metabolism
pss01100  Metabolic pathways
pss04020  Calcium signaling pathway
pss04114  Oocyte meiosis
pss04261  Adrenergic signaling in cardiomyocytes
pss04270  Vascular smooth muscle contraction
pss04371  Apelin signaling pathway
pss04540  Gap junction
pss04912  GnRH signaling pathway
pss04914  Progesterone-mediated oocyte maturation
pss04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102463305 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102463305 (ADCY3)
   04020 Calcium signaling pathway
    102463305 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102463305 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102463305 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102463305 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102463305 (ADCY3)
   04916 Melanogenesis
    102463305 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102463305 (ADCY3)
   04270 Vascular smooth muscle contraction
    102463305 (ADCY3)
Enzymes [BR:pss01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102463305 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA PRR18 fn3_4
Other DBs
NCBI-GeneID: 102463305
NCBI-ProteinID: XP_025037269
Ensembl: ENSPSIG00000009379
LinkDB
Position
Unknown
AA seq 1117 aa
MPGNRAFTEPEYSAEYSADYSVSLPSDPERGVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVLYTTDKLATIVVASVGLAAQIL
LFVLCKYGLLPDRVTRRFMPYILWILIAAQIFCYLGLNFAHFHQASDTVGWQAFFIFSFF
ITLPLRLTPIVLISAVSCGIHTLVLGVTIAQQQQDSINGGTLLREILSNIAIYLCTIMVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVGAISYVREKTKTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGTRCD
YLKEKGIVTYLILVPKPPVKNGINGVKLSLTSSHGNSPLLINTKECNGSINTTCTTPDEA
EELDTRALGGLAVSGHKEKGTSSGVPPSRTRALPLLFPLACGLPRFTGVRGVSGRLKGKY
TYRLSMRFINPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEALINPWLVANYVTFVIG
EILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMADIVDMLSC
LQSYSGTSNSTAATPLAGGCVEDPKYYSYIAVLALIATIMLVQVSHMVKLTLMVMITCAV
GVVNIYAWQQIFDEYDKGRFQEIVYTLVPSKYSMTVMIFIMMLSFYYFSRHVEKLARTLF
LWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFAS
LPNFADFYTEESINNGGIECLRFLNEIISDFDTLLDDPQFRCITKIKTIGSTYMAASGVT
PDVNTNGYTTTMKKEELSEKERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGMNKG
GVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEYGFRFVRRGAVY
VKGKGELMTFFLKGREKQGSFINGSSVTLPHQVVDSS
NT seq 3354 nt   +upstreamnt  +downstreamnt
atgcctgggaacagggctttcaccgagccggaatactctgccgagtactctgctgactat
tcggttagcctgccctcggaccccgaacgtggggtgggccggacccatgaggtgaccgtc
aggaactcgggctcgtgcctttgcttgccacgcttcatgcggctcaccttcgccccggag
tccctggagaatctctaccagacgtacttccggcggcagcgccacgagaccctcttggtg
ctggtggtctttgccgccctcttcgactgctacgtcatcgtcatgtgcgctgtgctctac
accacggacaagctggccaccatcgtggtggcctcagtaggcctggccgcccagatcttg
ctcttcgtcctatgcaagtacgggctcctgccggaccgcgtcacccgcagatttatgccc
tacatcctctggattctcatcgccgcccagatattctgctacctaggcctcaactttgcc
catttccaccaggccagtgacacagtgggctggcaggccttcttcatcttctccttcttc
atcaccttgcccctccgtctcacgcccatcgtgctcatctcggctgtctcctgtggcatc
cacaccttggtgctgggggtcaccatcgctcagcagcagcaggattccatcaatggaggg
accttgctacgggagatcctgtccaatattgccatctacctgtgcaccatcatggtgggc
atcatgtcgtactacatggcagaccgcaagcaccgcaaggccttcctggaagcacggcag
tctctcgaggtcaaactcaacctggaggaacaaagccagcagcaggaacggctgatgctt
tccatcctgcccaagcacgtggcagatgagatgctaaaggacatgaaaaaggacccaagc
cagaaagagatgcagcaatttaacaccatgtacatgtatcgccatgagaacgtcagcatc
ctctttgccgacatagtcggcttcacccagctgtcgtcctcctgcagcgcccaggagctg
gtgaagctgctgaacgagctctttgcccgctttgacaagctggcagcgaaataccaccag
ctgcgcatcaagatccttggagactgctactactgtatctgtgggctgccggactaccgt
gaggaccatgcggtctgctccatcctgatgggcctggccatggtgggagccatatcctat
gtgcgagagaagaccaaaacagacgtggacatgcgtgtgggggtccacagcggcacggtg
ctggggggtgtgctgggccagaagcgctggcagtacgacgtgtggtccacagacgtcacg
gtggctaacaagatggaggctggtggcatcccagggcgtgtgcacatctcccagagcacc
atggactgcttgaaaggggagtttgaggtggagcccggagaggggggcacacggtgtgac
tacctgaaggagaaggggatcgtgacgtacctcatcctggtgcccaagccgcctgtcaag
aacgggatcaatggagtgaagctgtccctgacgtcctcccatgggaactccccactgttg
atcaacaccaaggagtgtaacggcagcatcaacaccacctgcaccacacccgacgaggcc
gaggagctggacaccagggccctggggggcctggccgtctcgggacacaaggagaagggg
acgagctcgggagtgccccccagcagaaccagggccctccccctgcttttccccttggcc
tgtggcctcccacgcttcaccggggtccgtggtgtctccggcaggctgaaggggaagtac
acgtaccgcctctccatgcgcttcatcaaccccgagatggagacgcgctactccgtggag
aaggagaagcagagcggggccgccttcagctgctcctgcgtggtgctcttcttcaccgcc
ctggtggaggccctaatcaatccctggctggtggccaattacgtgacgtttgtcattgga
gagatcctgctgctcatcctgacactgtgctctctggccgccattttccccagggtgttt
cccaaaaaactcgtagccttttccacttggatcgacaggacccgctgggcccggaacacc
tgggccatgtcggccatctttatcctcaccatggccgacatcgtggatatgctcagctgc
ctccagtcctactccggcaccagcaacagcaccgcagcgaccccgctggcggggggctgc
gtggaggaccccaagtattacagctacattgctgtgctggccctcatcgccaccatcatg
ctggtgcaggtcagccacatggtcaagctcactctgatggtcatgatcacctgcgctgtg
ggcgtggtcaacatctacgcctggcagcagatcttcgacgagtacgataagggacgtttc
caggagatcgtgtacaccctggtcccctccaagtactccatgacagtgatgatcttcatc
atgatgctcagcttctactacttctctcgccacgtggagaagctggccaggacgttgttc
ctgtggaagatcgatgtccatgaccagaaggagcgggtgtatgagatgaggcgctggaac
gaggccctggtcaccaacatgttgccagagcacgtggcccggcatttcctgggctccaag
aaacgggacgaggagctgtacagccagtcgtatgacgaaattggcgtcatgttcgcctcc
ctcccaaactttgccgacttctacacggaggagagtatcaacaacggcgggatcgagtgc
ctgcgcttcctcaacgagatcatctcggattttgacacgctcctggacgacccacagttc
cggtgcatcaccaagattaaaaccattggcagcacctacatggctgcttcgggagtgacc
cccgacgtcaacaccaatggctacaccaccaccatgaagaaagaggagctttcggagaag
gagcgttggcagcacttagctgatttggctgactttgccttagccatgaaagtgaccctg
atgaacattaactaccagtccttcaacaacttcatgctccgaataggcatgaacaaagga
ggggtgctggcaggcgtgatcggcgcccgcaaaccacactacgacatttgggggaacacc
gtgaacgtggccagcagaatggagtcaacgggtgtgatgggaaacatacaggtggtggag
gagacccatctcatcctgaaggagtacggcttccgctttgtgcgccggggggccgtctac
gtcaaaggcaaaggggaactgatgaccttcttcctgaagggccgggagaagcagggctct
ttcatcaatggctcctcagtgactctaccgcaccaggtggtcgacagctcatga

DBGET integrated database retrieval system