KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102464024Help
Entry
102464024         CDS       T02980                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04210  Apoptosis
pss04625  C-type lectin receptor signaling pathway
pss04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102464024 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102464024 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102464024 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102464024 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102464024 (MAP3K14)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102464024 (MAP3K14)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: STE group
  Other
   102464024 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102464024
NCBI-ProteinID: XP_006111896
Ensembl: ENSPSIG00000018217
UniProt: K7GJX4
LinkDB All DBs
Position
Unknown
AA seq 938 aa AA seqDB search
MAVMEVACQGAPDPTIGHQKELAATKGLSETVGEKQSSVCKVEDSEKVAFHSQWKILKDV
ITKGTAKEETEGGSASISIIAQAECENSQQFLPTFSERPFIADSKRYSRSDNLDQIPNNV
AHATEGKMAPACWRARHRGKGRKKRRKKRSRVRIQTLAPAKQGPRTPEQESCTPIPVQED
ETHQNILFSNSSCFSEPCKDSISDQILFDKPRKVLLTDKLQSLRNPHRPELHKLISPVQC
LNHVWKLHCQGDFVPQPETLHPFPYNRLPSCISVLDGPLCAVKRNPLETYLRDDWACATS
EPRLSGLSLEHTFSKCVSQSTETTSDKLSVEEYLVDALKGSVSLGEPRNLASLAKTWRGG
GLDLKGQFQEADDNEGVLLTEKLKPVDYEYREEVHWTKCHDFLGIGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAGVTSPKVVPLYGAVKEGPWVTIFMELMEGGSLGQLIKQ
RGYLPEDRALSYLGQALDGLEYLHAHHILHGDVKADNMLLSRDGSRARLCDFGHSARLHP
DGLGKCLVTGSYMPGTETHMAPEVVMGKRCDSKVDIWSSCCMMLHMLNGCHPWTRYYNHP
LCLKIAKEPPPWREIPPSCNPSTAELIKAGLEKEPLRRASAAELKTKADTALQQVGDAKN
PSREYREPRRLSLDEENNPQASLSPTVSLISETVASPGSAFKAPCLSQSLQLAEKTGVTP
WNLCKELPRVCDPPSLSSLPPVPTKSSSSSERTTAISEQELQQLEIELFLNSLSQPYSLE
EQEQMLSCLSIDSPLVSDASEKSSLKGSQSLRDTMSSGVHSWCSQTDGQSFSWNNLLCRS
RHTDTPCYFNGVKIQIQLLSGENLHIREFHRTKVGDVATGISSQIPASAFSLVTKDGRPV
GCDMEVPDSGLELQCTLAPDCSFGWSWRVKHGQLENRP
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgatggaagttgcatgccaaggagctcctgaccccactatcgggcaccagaag
gagcttgctgctactaaagggctgagtgaaacagtgggtgagaagcagagcagtgtttgc
aaagtagaagattcagagaaagttgccttccacagtcagtggaagatcctgaaagatgtg
atcaccaaaggaacagcaaaagaagagacagaaggaggttctgcgtccatttccatcatt
gcccaggctgaatgtgagaacagccagcagttcctacccaccttttcagagaggcctttc
atagctgacagtaaacgttacagcaggtcagacaatcttgatcagatccctaacaatgtg
gcccatgctactgaggggaaaatggcaccagcctgctggagggcaaggcatcggggtaaa
ggcaggaagaaacgtcgcaagaaaagatccagggttcgaattcaaacactggcccctgct
aagcaagggcccagaactccagaacaagaaagttgtactccgatcccagtccaggaggat
gaaactcaccaaaacattctcttcagtaacagctcctgtttttcagaaccttgcaaggat
tcaatctctgatcagatactgtttgataaacctagaaaagttctgctcacagacaaactc
cagtcactaagaaacccacatagaccagagctgcacaagttaataagcccagttcagtgc
ttgaaccatgtttggaagttacactgtcagggggactttgtgcctcagccagagaccctc
catcccttcccttacaacagattgccctcttgcatctctgttctggatggtcctctttgt
gctgtgaagcgtaaccctttggagacttacctccgtgacgattgggcctgtgcgactagt
gagccacgcttgtctggcctaagcttagaacacaccttttcaaaatgtgtcagccagtcc
acggaaaccacctcggacaaactttctgtggaagaatatttggtggatgctcttaaaggg
agcgtgagcctcggggagcctcggaacttagccagccttgccaagacgtggagaggaggc
ggtctggatttgaaggggcagtttcaagaggcagatgacaacgagggggtgctgcttacg
gagaaattaaagccagtggactatgaataccgagaagaagttcactggaccaagtgccat
gacttcctgggcattggctcttttggggaagtgtacaaaatagaggacaaacagacggga
tttcagtgtgctgccaaaaaggtgcaagtcgaacactttcgtgcagaggagttgacgaca
tgtgctggagtaacaagtcccaaagttgtccctctgtatggagcagtgaaggaaggccct
tgggttactatcttcatggaactaatggagggtggctcattaggccagctgattaaacag
agaggttacttgccagaggatagagccctcagttacctgggtcaagcattggacggtctg
gagtatcttcacgctcatcacattctgcatggagatgtcaaagcggacaacatgctctta
tccagggatggaagccgggctcgcctctgtgacttcggccactctgctcgtcttcatcca
gatggcttggggaagtgcctagtgaccgggtcctacatgccgggcacagagacgcacatg
gctccagaggtagtaatgggaaagcgctgtgactcgaaggtggacatctggagcagctgc
tgcatgatgctgcacatgctcaatgggtgtcatccttggacccgctattacaaccaccct
ctgtgcttaaagatagccaaagagccgcctccttggagggaaatcccgccgtcctgtaac
ccttccacggccgagctcattaaagctgggctggagaaggagccgcttagaagagcttct
gcagccgagctgaagaccaaggctgacacagcacttcagcaggtgggagatgcaaagaac
ccctcgagagaatacagagaacctagacgtttgtctctggatgaagaaaacaacccacaa
gcttccctgtccccaacagtcagcctaatttctgagactgtggctagcccagggtcagcg
ttcaaagctccatgcctgtcccaaagcctgcagctggcagagaagactggggtaacccct
tggaatctgtgcaaggagttacctagggtttgtgatccaccttccctctcctccctgcct
cctgtccccaccaagagcagcagctcctcggaacggacaacagctatctcagaacaggag
cttcagcagctggaaatagagttgtttttgaacagcctgtcccagccgtactctctggag
gagcaggagcaaatgctctcatgtctcagcatcgacagcccgctcgtgtcggatgccagc
gaaaagagctctctgaagggttcccagagcctgagggacaccatgagctcgggggttcat
tcctggtgcagccagactgacggacagagcttcagctggaacaacctgctgtgtcgcagc
cggcacacagacaccccctgctacttcaatggagtgaaaatccagatccagttgctaagt
ggagaaaatcttcatatccgagagttccacaggaccaaggtgggagacgttgctactggg
ataagcagccagataccagcctccgctttcagccttgttacaaaggacggccggcctgtt
ggctgtgacatggaggttcccgactcgggcctagagctgcagtgcaccctggctcctgac
tgcagtttcggctggtcctggcgagtcaagcatggtcagctggagaacagaccgtga

DBGET integrated database retrieval system