KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0371
Entry
PSPTO_0371        CDS       T00118                                 

Gene name
iaaL
Definition
(RefSeq) indoleacetate-lysine ligase
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
KEGG Orthology (KO) [BR:pst00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSPTO_0371 (iaaL)
Enzymes [BR:pst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     PSPTO_0371 (iaaL)
SSDB
Motif
Pfam: AMP-binding Aconitase_C
Other DBs
NCBI-GeneID: 1181980
NCBI-ProteinID: NP_790220
UniProt: Q88AL8
LinkDB
Position
406323..407510
AA seq 395 aa
MTAYDVEKEWSRISNTAAKTHQNNDFEGFTYQDFRTHVPIMDKEGFAAQTERCLERNERN
CLIGFTSGTSGNLKRCYYYYDCEVDEDSSRSNVFRSNGFIQPGDRCANLFTINLFSALNN
ITTMMAGNCGAHVVSVGDITLLTKSHFEALNSIKLNVLLGVPSTILQFIDAMQQHGVHID
IEKVVFNGEGLKTFQKKIIREAFGEQVSIVGVYGSSEGGILGFTNSPCHTEYEFLSDKYF
IEKEGDSILITSLTRENFTPLLRYRLGDTATLSLKGDKLYLTDIQREDMSFNFMGNLIGL
GIIQQAIKQTLGRTLEIQVHLSVTDARKELVTVFVQASEVNEDERARIETAIADIPDINE
AYQKDQGSVLVVRKDARDYAVSERGKMLYIIDRRN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgactgcctacgatgtagaaaaggaatggagcagaatttccaatactgccgctaaaact
caccagaacaacgattttgaaggtttcacctaccaggacttcagaacccacgtaccgatc
atggacaaggaaggcttcgcggcacaaaccgaacgctgccttgagcgcaacgagcgcaac
tgcctgatcggctttaccagtggcaccagcggcaacctcaaacgctgttattactactac
gactgtgaagtcgatgaagacagttcccgctccaacgtcttccgcagcaatggtttcatt
caacccggtgatcgctgcgccaacctgttcaccatcaacctgttttctgccctgaacaac
atcaccaccatgatggccggtaactgcggtgcgcatgtggtgtccgtaggcgatatcacc
ctgctgaccaagagtcacttcgaggcgctcaactcgatcaagctcaacgtactgctcggc
gtaccctcgaccatcctgcagttcatcgatgccatgcagcagcacggtgtgcacatcgat
atcgaaaaggtcgtcttcaatggcgagggcctgaaaacctttcagaagaaaatcatcagg
gaagcctttggcgaacaggtctccatcgtcggcgtatatggcagttccgagggcggcatt
ctgggtttcaccaacagcccttgccacaccgaatacgagtttctttccgacaaatacttc
atcgagaaagaaggcgacagcatcctcatcacctcgttgacccgcgagaacttcacaccg
ctgctccggtatcgcctgggagacaccgcaacgctttcgctgaaaggcgacaagctctat
ttgactgacatccagcgggaggacatgagcttcaacttcatgggcaacctcattggtctg
ggcatcattcaacaagcgatcaaacagacactgggccgcacgctggaaatccaggttcac
ctgtcagtgactgatgcgcgcaaagaactggtgaccgttttcgttcaggcctcggaagtc
aacgaagatgaacgcgccagaatcgaaacagccatcgccgatattccggacatcaacgag
gcctatcagaaagaccagggcagcgtgctggttgtgcgcaaggatgccagagactacgcc
gtctcggagcgaggcaaaatgctctacatcattgaccgcaggaattga

DBGET integrated database retrieval system