KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0550Help
Entry
PSPTO_0550        CDS       T00118                                 

Gene name
apaG
Definition
(RefSeq) apaG protein
  KO
K06195  ApaG protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
KEGG Orthology (KO) [BR:pst00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PSPTO_0550 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-GeneID: 1182160
NCBI-ProteinID: NP_790397
UniProt: Q88A47
LinkDB All DBs
Position
complement(604171..604551)
Genome map
AA seq 126 aa AA seqDB search
MSDSRYKVDVSVVTRFLAEQSQPEQNRFAFAYTITVHNNGELPAKLLSRHWIITDGDGHV
EEVRGEGVVGQQPLIKVGQSHTYSSGTVMTTQVGNMQGSYQMLAEDGKRFDAVIEPFRLA
VPGSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattctcgttacaaggtcgacgtcagcgtcgtcacgcgcttcctcgcagaacaa
tcgcaacccgagcagaaccgcttcgctttcgcctacaccatcaccgtgcacaataacggc
gagttgcctgccaagctgctgtcacggcactggatcatcaccgatggcgacggtcatgtc
gaagaagtgcgtggcgaaggggtggtcggtcaacaaccgttgatcaaggtcgggcaaagc
catacttacagcagcggcacggtaatgaccactcaggtgggcaatatgcagggcagctac
cagatgctggctgaagacggcaaacgcttcgatgcggtgatagaacccttccgtctcgcc
gttccgggctcactgcactga

DBGET integrated database retrieval system