KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0824Help
Entry
PSPTO_0824        CDS       T00118                                 

Gene name
pilS
Definition
(RefSeq) sensor protein PilS
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSPTO_0824 (pilS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pst01001]
    PSPTO_0824 (pilS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pst02022]
    PSPTO_0824 (pilS)
   02035 Bacterial motility proteins [BR:pst02035]
    PSPTO_0824 (pilS)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PSPTO_0824 (pilS)
Protein kinases [BR:pst01001]
 Histidine kinases
  NtrC family
   PSPTO_0824 (pilS)
Two-component system [BR:pst02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   PSPTO_0824 (pilS)
Bacterial motility proteins [BR:pst02035]
 Pilus system
  Twitching motility proteins
   PSPTO_0824 (pilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 PAS_7 HATPase_c_2 PAS HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 1182449
NCBI-ProteinID: NP_790671
UniProt: Q889C6
LinkDB All DBs
Position
complement(890930..892525)
Genome map
AA seq 531 aa AA seqDB search
MTAETPSLTSPQAQRILRLYHLYRLTIGVVLVLLISSSLETELLQLANPNLFRSGCWLYL
VFNILVVVLLERPSRQAQLFGLAMTDAIMLSGLFYAAGGPSSGIGNLLIASVAISNVLLR
GRIGLLIAAVSAIGIIYLTFYISFGTPSVSNDYVQAGSLGALCFAAALLVQALTARLQVS
EGLAEQRAADVDSLEELNALILQRMRTGIVVLDARRQVVLANQGALTLLGHERLVGQVID
AYSPQLVERLRQWLINPIMVPRSITTSSIGPVLQPSFAALNRGDQRQTLIFLEDLSQIAH
QAQQLKLAALGRLTAGIAHEIRNPLGAVSHAAQLLNESEDLSAPDRRLGQIIHDQSQRID
RVIENVLQLSRRREAQPELLDLKVWLENFVSDFRSSAAADQSIHVQISSGMLTTRMDAGQ
LTQIITNLVQNGLRYSRRNHPSAQVWLNLHHDRESDLPILEVLDDGPGVSEQHLSKIFEP
FFTTESKGTGLGLYLSRELCESNQAHLEYIPRPHDGGSCLRITFAHPFKTS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctgagacgccttcgcttaccagcccgcaggcgcaacggattctgcggctgtat
cacctttatcgactgaccattggcgtcgtgctggttctgttgatctccagcagcctggaa
accgagttgctgcaactggccaatccgaatctgttccgttcgggctgctggctgtacctg
gtgttcaacattctggtggtggtgctgctggagcgccccagccgccaggcgcagctgttt
ggcttggcgatgaccgacgcaatcatgctttccgggctgttttatgcggccggcgggccg
tcgagcggcatcggcaacctgttgatcgcatccgtggcgatcagcaacgtgctgctgcga
ggccgcatcggcctgttgatcgctgctgtttctgccattggcatcatctacctgacgttc
tacatcagcttcggcacaccttcggtgtccaacgactacgtgcaggccggttctctgggt
gcgctgtgcttcgccgccgcgctgttggtgcaggcactgactgcgcgcctgcaagtcagc
gaggggctggccgagcaacgggcagcggatgtcgacagccttgaagagctcaatgcgctg
atcctgcagcgcatgcgcacaggcattgtggtactggatgcgcgccgccaggtggtgctg
gccaatcagggggccttgaccctgctcggccatgaacgattggtcggtcaggtcatcgac
gcttactcgccgcagttggtcgagcgcctgcgccagtggctgatcaacccgatcatggtg
ccgcgcagcatcaccacctcatctatcgggcctgtgctgcaacccagctttgccgcgctc
aatcggggcgaccagcgtcaaacgctgatcttccttgaagatctgtcgcagattgcccat
caggcgcagcagctcaagcttgctgcgctgggccgcctgaccgcaggcatcgcccacgaa
atacgcaacccgttgggtgcggtcagccatgctgcgcagttactcaacgagtcggaagac
ctcagcgcgccggatcgccgtctggggcagatcattcatgatcagtcgcagcgcattgat
cgggtgattgaaaacgtcctgcaattgtctcgccgacgcgaagcacaacccgaactgctc
gacctgaaagtctggctggaaaattttgtcagcgactttcgtagctcggccgctgcggat
cagtcgattcatgtgcaaataagctcaggcatgctgaccactcgcatggacgccgggcaa
ctgacccagatcatcaccaacctggtgcagaacggcctacgctacagccgccgcaatcac
ccgtcggcgcaggtctggctgaacctgcaccatgaccgggaaagcgatttacccatcctg
gaagtgctggacgacgggccgggtgtcagcgaacaacacctgagcaagattttcgaaccg
tttttcaccacggaaagcaaaggcaccggcctgggtctatacctttcccgtgaattgtgc
gaaagcaatcaggcgcatctggaatatatcccccgaccacacgacggtggcagctgtttg
cgcatcaccttcgcccacccgttcaaaacgagctga

DBGET integrated database retrieval system