KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1338Help
Entry
PSPTO_1338        CDS       T00118                                 

Gene name
sodC
Definition
(RefSeq) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSPTO_1338 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 1182974
NCBI-ProteinID: NP_791165
UniProt: Q887F8
LinkDB All DBs
Position
1468578..1469096
Genome map
AA seq 172 aa AA seqDB search
MKPHLLLGLLGAFSLSVQAASLDVPINLVSADGAPKLIGSVTVSETEYGLLFTPKLNGLP
AGIHGFHVHENGSCEAGTKDGVKVAALAAGGHFDPAKTGKHLGPYARGHLGDLPALYVTA
DGTADYPVLAPRLKKLSEIKGHALMVHAGGDNHADMPKPLGGGGDRAACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcatcttttgcttggccttcttggcgccttttccctcagcgttcaggcagca
tcgctggacgttccgatcaatctggtcagcgctgacggcgcgcccaaactgatcggcagc
gttacggtgagcgaaacagagtacggcttgctgttcaccccaaagctgaacggtctgcct
gcgggcattcacggtttccacgtgcatgaaaacggtagttgcgaggcaggcaccaaggac
ggcgtgaaggttgcggcactggcggccggtggtcactttgacccggccaagaccggcaaa
cacctggggccttatgcgcgaggtcacttgggcgacctgcccgcgttgtacgtcacggct
gacggcactgccgactatccggtattggcaccgcgcctgaaaaaactgtccgaaatcaaa
ggccatgcattgatggttcatgccggcggcgataaccacgccgacatgcctaaacctttg
ggcggcggcggtgaccgtgctgcttgcggtgtgatctga

DBGET integrated database retrieval system