KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1545Help
Entry
PSPTO_1545        CDS       T00118                                 

Gene name
fabZ
Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00061  Fatty acid biosynthesis
pst00780  Biotin metabolism
pst01100  Metabolic pathways
pst01212  Fatty acid metabolism
Module
pst_M00083  Fatty acid biosynthesis, elongation
pst_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSPTO_1545 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PSPTO_1545 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pst01004]
    PSPTO_1545 (fabZ)
Enzymes [BR:pst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PSPTO_1545 (fabZ)
Lipid biosynthesis proteins [BR:pst01004]
 Fatty acid synthase
  Component type
   PSPTO_1545 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-GeneID: 1183182
NCBI-ProteinID: NP_791370
UniProt: Q886N2
LinkDB All DBs
Position
1705293..1705733
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVTELDIENKNIRAYKNVSVNEPFFNGHFPQHPIMPGVL
IIEAMAQAAGILAFKMLDSKPSDGTLYYFVGSDKLRFRQPVFPGDKLVLEATFLSSKRQI
WKFECKATVDGKAVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgaaattcgcgaatacctgcctcatcgttacccgttcctgctggtg
gaccgcgtgaccgagctggatatcgagaacaagaacattcgcgcctacaagaatgtcagc
gtcaacgagcctttcttcaacggtcacttcccccagcatccaatcatgccgggcgttctg
atcattgaggccatggctcaggctgcgggtattcttgcgttcaagatgctcgactccaag
ccatccgacggcacgctctattatttcgtaggttcggacaagctgcgcttccgccaaccg
gtttttccgggtgacaaactggttcttgaagcaacgtttctgagcagcaaacgccagatc
tggaagtttgagtgcaaggccaccgttgatggtaaagcggtatgctctgccgaaatcatc
tgtgcggaacgcaagctatga

DBGET integrated database retrieval system