KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1779Help
Entry
PSPTO_1779        CDS       T00118                                 

Definition
(RefSeq) class I and II aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00220  Arginine biosynthesis
pst00250  Alanine, aspartate and glutamate metabolism
pst00290  Valine, leucine and isoleucine biosynthesis
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01130  Biosynthesis of antibiotics
pst01210  2-Oxocarboxylic acid metabolism
pst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSPTO_1779
   00290 Valine, leucine and isoleucine biosynthesis
    PSPTO_1779
   00220 Arginine biosynthesis
    PSPTO_1779
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pst01007]
    PSPTO_1779
Enzymes [BR:pst01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PSPTO_1779
    2.6.1.66  valine---pyruvate transaminase
     PSPTO_1779
Amino acid related enzymes [BR:pst01007]
 Aminotransferase (transaminase)
  Class I
   PSPTO_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-GeneID: 1183416
NCBI-ProteinID: NP_791604
UniProt: Q885Q2
LinkDB All DBs
Position
complement(1948745..1949956)
Genome map
AA seq 403 aa AA seqDB search
MQFNKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLVPAPDYPLWTAAVALSGGSPVHYLCDEQANWWPDLEDIKAKITPNTKAMVIINPNNPT
GAVYSREVLLGMLELARQHNLVVFSDEIYDKILYDDAVHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWIAISGPKHNAQSYIEGIDILANMRLCANVPSQHAIQTALGGYQSINDLIL
PPGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIFNDEKFVLDLLLSEKL
LVVQGTAFNWPYPDHFRVVTLPRVDELEQAIGRIGNFLKGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcaacaaatcgaacaagctcgcaaacgtctgctacgacattcgcgggccagtg
ctcaagcacgccaaacgcctggaagaggaaggccatcgcatcctcaagctgaatatcggc
aacccggcaccgtttggtttcgaggcgccggacgaaatcctgcaggacgtgatccgcaac
ctgccgaccgctcagggctacagcgactccaagggcctgttcagcgcccgcaaggcggtc
atgcagtactaccagcagaagcaggtcgaaggtgtcggcatcgaagacatctacctgggc
aacggcgtttccgagctgatcgtgatgtcgatgcaggcgctgctaaataacggcgacgaa
gtgctggttccggcacccgattacccattgtggaccgccgcagttgcgctgtccggtggc
agcccggtgcattatctgtgcgacgagcaggccaactggtggcctgaccttgaagacatc
aaggccaagatcacgccgaacaccaaggccatggtcatcatcaacccgaacaaccccacc
ggtgcggtgtattcccgcgaagtgctgctgggcatgctggagctggcccgtcagcacaac
ctggtggtgttctccgacgaaatatacgacaaaatcctgtatgacgacgccgtgcatatc
tgcaccgcctcgctggcgccggacctgctgtgcctgaccttcaacggcttgtcgaaatcg
taccgcgttgcgggcttccgctcgggctggatcgccatttccgggccgaaacacaacgcg
cagagctacatcgaaggcatcgacattctggccaacatgcgcctgtgcgccaacgtgcct
agccagcacgccatccagaccgcgctgggcggctaccagagcatcaatgacctgatcctg
ccaccaggtcgcctgctggagcagcgcaaccgcacctgggagttgctcaacgacattccc
ggcgtgagctgcgtcaagccgatgggcgcgctgtatgcgttcccgcgcatcgacccgaag
gtctgcccgatcttcaacgacgagaagtttgtgctcgacctgctgctctcggaaaaactg
ctggtggttcagggcactgcgttcaactggccttatcctgaccacttccgcgtggtgacc
ctgcctcgggtcgacgagctggagcaggccattggccgcatcggcaacttcctcaagggt
tatcgtcagtaa

DBGET integrated database retrieval system