KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2636Help
Entry
PSPTO_2636        CDS       T00118                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00010  Glycolysis / Gluconeogenesis
pst00052  Galactose metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_2636 (galM)
   00052 Galactose metabolism
    PSPTO_2636 (galM)
Enzymes [BR:pst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSPTO_2636 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1184288
NCBI-ProteinID: NP_792444
UniProt: Q882J1
LinkDB All DBs
Position
complement(2929175..2930323)
Genome map
AA seq 382 aa AA seqDB search
MKKHALLSTFGLSLMISTLTAQAAALSSEHSAFGQLPDGSAIEKYTLRNSHGVQASIITY
GATLQSLLVPDKAGKVEDIVLGFDDVQGYQSNGTVYFGATIGRFGNRLAGGKFSLDGKTY
QVPLNDKTNALHGGDKGFDKRLWKAEETRTGDSVGVKLTYVSPDGEMGFPGTLQTEVTYS
LNDKNELKIDYRATTDKPTVLNLTNHSYFNLAGAGSGDVLKQVATLHASHYTPVNDKLIP
TGELPAVAGTPMDFLKPTAFGKHIKDDHQQLKYAEPKQGGFDFNWVLDSKGDVKKLAAEV
SDPQSGRTLQLFTTEPGVQLYTGNFLDGSIHGKGGKVYPHWGAFTLETQHYPDAPNQPKF
PSTRLDPGKAYTQTTVFKFLNN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcatgctcttctcagcacctttggactgtccttgatgatcagtaccttgacc
gcacaggccgcagcactctccagcgaacacagcgcgtttgggcaactgcccgatggcagc
gccatcgagaaatataccctgcgcaacagccatggcgtgcaggccagcatcatcacttat
ggcgcaaccctgcaatcactgctggtgcccgacaaggctggcaaggtggaagacatcgtg
ctgggcttcgacgatgtgcagggctatcagagcaacggcacggtttattttggcgcgacc
atcggccgtttcggcaaccgtctggcgggcggcaaattcagtctggatggcaagacctac
caggttccgctcaacgacaagaccaatgccctgcacggcggcgacaagggtttcgacaag
cgactctggaaggcggaagaaaccaggaccggtgattcggtcggcgtgaaactgacctac
gtgtcgccggatggcgagatgggtttcccgggcacgttgcagactgaagtcacctacagc
ctgaacgacaagaatgaactgaaaatcgactaccgcgccaccaccgacaaacccacggtg
ctgaacctgaccaaccacagctatttcaacctcgcgggcgcaggcagcggcgatgtgctc
aagcaggtcgccacccttcacgcttcgcactacaccccggtcaacgacaagctgatcccg
acgggcgaactgcccgccgtcgccggcacgccgatggacttcctcaagcccaccgcgttt
ggcaaacacatcaaggatgaccaccagcagctgaaatatgccgaacccaaacagggcggc
tttgatttcaactgggtgctggacagcaaaggcgatgtgaagaaactcgccgccgaggtc
agcgacccgcaatcgggccgcacgctgcaattgttcactaccgagcccggcgtgcagctg
tacaccggcaacttcctggatggcagcattcacggcaagggcggcaaggtctatccgcac
tggggcgctttcacgctggaaacccagcactaccctgacgcgcccaaccagccgaaattc
cccagcacgcgactggacccaggcaaagcctacacccagaccactgtgttcaaattcctg
aacaactga

DBGET integrated database retrieval system