KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2761Help
Entry
PSPTO_2761        CDS       T00118                                 

Definition
(RefSeq) alpha-amylase family protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00500  Starch and sucrose metabolism
pst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPTO_2761
Enzymes [BR:pst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSPTO_2761
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PSPTO_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 1184415
NCBI-ProteinID: NP_792566
UniProt: Q881X1
LinkDB All DBs
Position
3076368..3079694
Genome map
AA seq 1108 aa AA seqDB search
MAKKPDAATFIKDPLWYKDAVIYQVHVKSFFDANNDGIGDFAGLIEKLDYIAALGVNTIW
LLPFYPSPRRDDGYDISEYRDVHSDYGTMADAKRFIAQAHKRGLRVISELVINHTSDQHP
WFQKARNAKPGSKARDFYVWSDTDQKYDGTRIIFLDTETSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPHVLDAVLEVMRFWLDLGIDGLRLDAIPYLIERDGTNNENLPETHQVLKRIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDSKGPDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPENCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLVERDRRRVELLNSMLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPMYGFQSVNVESQERDPHSLLNWNRRMLAVRKQQKAFGRGTLKM
LSPSNRRILAYTREYTAPDGHSEVVLCVANVSSAAQAAELDLSGYAGTVPVEMLGGSAFP
PIGQLNYLLTLPPYGFYWFLLATENQMPSWHVEPAQSMPDFPTLVLKKRLEELLEEPLRS
TMEDTSLTVYLPKRRWFAGKDKAIEKVNIAYAVRFGDEAHPVLLSEIEVTAGGQTDRYQL
PFGLLGEDDISSALPQQLALARVRRSRDVGLITDAFTLETFIRAVIQGMQSDTVIPCADG
QLRFEQSSQLAPLGLTHESEVRYLSAEQSNSSVVVGSSLVLKLIRKVSAGTHPELEMGAF
LTHAGFKNISPLLGSLVRVGNDGQPNLLMIAQGYLSNQGDAWEWTQNNLERAVRDELAHG
VSGQEQHYNALLELADFSRSLGQRLGEMHQILASPTDNADFAVEITSAQDSKASATSVNA
QLERALQLLEQRKGDLDKDDQQLVSDLLAHRKQIRQRVEGLAKRSAGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARALEERRAKHSPFKDVSGVLRSFDYAAAMAVRSAQSVDTSP
QAAAARKQVAETYLAQAREAFIEGYRLATSGIAHAWKDAKGEDSALELFTLEKAAYEVIY
EAENRPAWLAVPLQGLRGLLQPSDGEPI
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagcccgatgccgcgacattcatcaaagacccgctctggtacaaggatgcg
gtgatctatcaggttcatgtgaagtcgtttttcgacgccaacaatgatggcatcggcgac
ttcgccggcctgatcgaaaagctcgactatattgccgcgctgggggtcaacacgatctgg
ctgttgccgttttacccgtctccgcgccgggacgacggctacgacatttccgagtaccgc
gacgtccatagcgattacggcaccatggccgacgccaagcgcttcatcgcccaggcgcac
aagcgcggcctgcgggtgatcagcgaactggtcatcaatcacacgtccgaccagcatcct
tggtttcagaaggcgcgcaacgccaagcctggctccaaggcccgtgatttctacgtgtgg
tcggacaccgaccagaagtacgacggcacgcgcattatctttctcgacaccgagacatcc
aactggacttgggacccggtcgccggccagtatttctggcaccggttctactcgcaccag
ccggatctgaacttcgacaacccgcacgtgctggatgcggtgctggaagtcatgcggttc
tggctggatctgggtatcgatgggttgcgcctggatgctattccgtacctgatcgaacgc
gatggcaccaacaacgagaacctgccggaaacccatcaggtgctcaagcgtatccgcgcc
gagatcgatgccaattacccggaccgcatgctgctcgccgaggccaatcaatggccggaa
gacacgcagctgtattttggtgacagcaaggggccggacggtgacgaatgtcacatggcg
tttcactttccgctgatgccgcgcatgtacatggcgctggcgcaggaagaccgctttccg
atcaccgacattttgcgccagacgccggaaattccggaaaactgccagtgggcgattttc
ctgcgcaaccacgatgaactgaccctggaaatggtcacggatcgtgagcgtgattacctg
tggaattactacgcggccgaccggcgtgcgcggatcaacctcggcatccgtcggcgtctt
gcgccactggtcgagcgtgaccgtcgccgcgtcgaactgctgaacagcatgttgctgtcg
atgcccggtacaccgacgttgtattacggtgacgaaatcggcatgggcgacaacatttat
ctgggcgaccgagacggtgtgcgtacgccgatgcagtggtcgattgaccgcaatggcggt
ttctcgcgtgccgatccggccagcctggtgctgccaccgatcatggacccgatgtatggt
ttccagtcggtcaacgtcgaaagccaggagcgtgacccgcattcgctgctcaactggaac
cgccgcatgcttgccgtgcgcaagcagcagaaggcgttcggccgcggcacactgaaaatg
ctttcgccgtccaaccgacgcattctggcctacacccgtgagtacactgcgccagacggt
cacagtgaagtggtgctgtgtgtggccaacgtgtccagtgcggcgcaggcggcagagctg
gatctgtcgggctacgccggcacggtcccggtggaaatgcttggcggcagcgcctttccg
cctattggccagttgaattacctgctgacactgccgccgtacggcttttactggtttcta
ttggctacggagaatcaaatgcccagctggcacgttgaaccggcgcaaagcatgccggac
tttccgaccctggtgctcaagaagcgtcttgaagagctgctcgaagagccgctgcgcagc
accatggaagacacctcgctgacggtctatctgcccaagcgccgctggtttgcgggaaag
gacaaggccatcgagaaggtcaacatcgcctatgcagtgcgttttggtgacgaggcgcac
ccggtgctgctcagtgaaatagaagtgaccgctggcgggcagactgatcgctatcaactg
ccgttcggcctgctgggcgaagacgacatcagcagcgcattgccgcaacaactggcactg
gcccgcgtgcgtcgcagccgcgatgtagggctgatcaccgatgccttcaccctggaaacc
tttattcgtgcagtaattcagggtatgcaatcggacacggtcatcccgtgtgccgacggc
caattgcgtttcgagcaaagttcgcagcttgcgccgctgggcctgacccatgagtccgag
gttcgttatctgtctgccgagcagtccaacagttcggtggtggtcggcagcagcctggtg
ctcaagctgattcgcaaagtcagcgccggcacgcaccctgagctggaaatgggggcattc
ctgacccatgccggcttcaagaatatctcgccattgctgggttcactggtgcgcgtcggc
aacgacggtcagccgaatctgttgatgatcgctcaaggctacctgagcaatcagggcgat
gcgtgggaatggacgcagaacaacctggaacgtgcggtgcgcgacgagttggcgcatggc
gtgtccggtcaggaacagcattacaacgccttgcttgaactggcggacttttcgcgcagc
ctgggtcagcgactgggtgaaatgcaccagattctagcgtcgccgactgataacgcagat
tttgcggtcgaaattaccagcgctcaggacagcaaggcgtccgccaccagcgtcaacgca
cagcttgagcgcgccctgcagttacttgagcagcgcaagggcgatctggacaaggatgat
cagcagttggtcagcgacctgcttgcgcaccgcaagcagattcgccagcgtgtcgaaggc
cttgccaaacgctcggccggtggcctgcgcattcgggtgcacggtgacctgcacttgggc
caggtgctggtcgtgaagggggatgcctacctgatcgactttgaaggcgagcccgcccgt
gcgcttgaagaacgccgcgctaagcacagcccgttcaaggacgtcagtggcgtactgcgt
tcattcgactacgctgccgcgatggccgtgcgcagtgcgcaaagcgtcgatacctcgccg
caagccgcagccgcacgcaaacaggtcgccgagacgtacctagcgcaggcccgcgaagcg
tttatcgaaggatatcgcttggcaacctccggcatcgcgcacgcctggaaagatgcaaaa
ggggaggactccgcactggagctgttcaccctggaaaaagccgcttatgaagtgatctac
gaagccgagaatcgtccagcctggttggccgttcctttgcaaggcttgcgtgggttgctg
caaccgtctgatggagaaccgatatga

DBGET integrated database retrieval system