KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3107Help
Entry
PSPTO_3107        CDS       T00118                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
KEGG Orthology (KO) [BR:pst00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSPTO_3107 (ahpF)
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSPTO_3107 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C Thi4 Glutaredoxin FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-GeneID: 1184764
NCBI-ProteinID: NP_792899
UniProt: Q880P7
LinkDB All DBs
Position
complement(3492875..3494437)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGTDAR
TPSFSLSSPGHDISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRALQGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPGIKHVAIDGALFQDEVTERKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKQSFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADKLIPGAAGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVLTSAQTTEVTGDEQ
KVNGLRYKNRTTGEEITIPLEGIFVQIGLLPNSEWLKGALELSPRGEIVVDARGETSVSG
IFAAGDVTVTPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctacctggagcgggtcactcgcccc
atcgagatcgtcgcgtcccttgatgacggcgcgaagtctcaggaaatgctcgcactgctc
aacgacgtgatcagtgtttccaaagacgtcaccctgaatgacagcggtaccgacgcacgt
acgccgtcgttctcgctgagcagccctggccacgatatcagcctgcgtttcgccggtatc
cccatgggccacgaattcacctcactggtattggcgctgctgcaagttggcggctaccca
cccaaggtcagtgcggaaaccatcgagcaggttcgcgctctgcaaggcgaattccatttc
gaaacctatttctcgcagtcctgccagaactgcccggacgtcgtccaggcgttgaacctg
atggcagtattgaaccctggcatcaagcacgtcgccatcgacggcgcgctgttccaggac
gaagtcaccgaacgcaagatcatgtcggtgccgagcatctacctgaacggagagctgttc
ggtcagggccgtatgggcctggaagaaattctcgccaagatcgacaccggtgccggtgcg
cgtcaggccgagaagctcaacgccaagcagtcctttgatgtgctggtggtgggtggcggt
cctgccggttcggcggctgcggtctatgccgcccgcaaaggcatccgcaccggcgttgca
gccgagcgtttcggtggtcaggtgctcgacaccatggctatcgaaaacttcatctcggta
caacacactgaagggccgaagctggctgttgcgctcgaagagcacgtcaagcagtacgaa
gtcgacatcatgaacctgcaacgcgccgacaagctgattccgggcgcggccggtgagttg
cacgaagtgaagttcgccagcggcgcgagcctcaaggccaagacggtgatccttgccacc
ggcgcgcgctggagggagatgaacgttcccggtgagcagcaataccgcaacaagggtgtg
gcctactgcccgcactgcgacggtccgctgttcaaaggcaaacgcgttgccgtgattggt
ggcggtaactcgggcgtcgaagcggccatcgacctggcgggtatcgtgtctcacgtaacg
ctgctggaattcgacgtgcaactgcgcgccgatgcagtgttgcaacgcaagctgcacagc
ctgccgaacgtcaccgtgcttaccagtgcgcaaaccactgaagtgactggcgacgagcag
aaggtcaatggcctgcgttacaagaaccgcacgactggcgaagaaatcaccattcctctg
gaaggtatttttgtgcagatcggcctgttgcccaacagcgaatggctcaaaggcgccctt
gagttgtcgccgcgtggcgagatcgtggtggatgcgcggggtgaaacgtcagtgtcgggc
atcttcgctgccggtgacgtgaccgtgacgccgtacaagcagatcatcatcgccctgggc
gagggtgccaaggcctcgctgagcgcttttgatcacctgatccgtacctccgcgccagcc
tga

DBGET integrated database retrieval system