KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3464Help
Entry
PSPTO_3464        CDS       T00118                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pst00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PSPTO_3464
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pst03400]
    PSPTO_3464
Enzymes [BR:pst01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PSPTO_3464
DNA repair and recombination proteins [BR:pst03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PSPTO_3464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 1185129
NCBI-ProteinID: NP_793244
UniProt: Q87ZG5
LinkDB All DBs
Position
complement(3908246..3910801)
Genome map
AA seq 851 aa AA seqDB search
MVKPASEYTRKRNFDVTSEPLESKRKGKARSGALSFVIQKHDARNLHYDFRLELDGTLKS
WAVPKGPSLDPKQKRLAVHVEDHPLDYAAFEGSIPKGQYGGGDVIVWDRGIWQPHGDPRK
TYEDGKLKFTLIGEKLSGEWALVRTRLKGSGSKEQWLLIKEKDDIARPAAEYDITEAQPQ
SVISGAHVGAGRSAPAKPKAKAVEAKPARKPAPKKAKAVFPDTFAPQLATLVDAPPAGDW
LYEIKFDGYRMLTRIQNDEVRLFTRNGNDWTDQLPELTKALKGLKLQDSWFDGEVVVLDE
QGLPDFQGLQNAFDEGHSKNIFYYLFDMPFLSGEDLREVPLEQRRDALKQVLGSQRSRLL
RYSDAFQAGHQDIVASAAAMGLEGVIGKRAGSAYVGKRNADWIKLKCRLRQEFVIVGYTA
PQGSRSAFGALLLAVNDDAQGLVYAGRVGTGFTEATLKHVHKQLKPLHREESPLAKKLTS
AQARGVQWVEPTLVCEAEFAQWTREGIVRQAAFFGLRGDKPAGDVVREDAQPAEAASVTP
EPSRQPGKKTARGKVDVAGTGISHPQRVIDSTTGTKKIELAQFYESIADWILPYLNKRPV
ALLRCPEGIDGEQFFQKHAEHLAIPHIRQLDRALDPGHAALMEIDSVQALVGAAQMGAIE
LHTWGATRDRIETPDHFVLDLDPDPALPWRSMIEATQMVLAVLEELGLEAFLKTSGGKGM
HIIVPLARQAEWDTVKAFAKAIAEFISRQLPERFTATMGPKNRVGKIFIDYLRNSRGGST
VTAYSVRARPGLPVSVPIALHELTGLTSSAQWDITNLEQRLSQLKSDPWAGYSNRRKITQ
KMWKQLGAKQP
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagccagccagtgaatacacgcgcaagcgcaactttgacgtcacctccgagcct
ttggagagcaaacgtaaaggcaaggcgcggtccggtgcactgagttttgtgattcagaag
cacgatgcgcgcaacctgcattacgactttcggctggaactggacggtacgctgaagagc
tgggcggtgcccaaagggcccagcctggacccgaaacagaagcgtctggccgtgcatgtc
gaagatcatccgctggactacgccgcttttgaaggcagcattccgaagggccagtacggc
ggaggcgatgtaatcgtctgggacaggggcatctggcaaccccatggtgatccacgcaag
acctatgaggacggcaaactcaagttcaccctgatcggcgaaaaactcagtggcgagtgg
gcgctggtgcgcactcggctcaagggcagtggcagcaaggagcagtggctgctgatcaag
gaaaaggacgacatcgcgcgacctgccgccgaatacgacatcaccgaggcgcaaccgcaa
agcgtgatcagcggtgcgcacgtcggggcagggcgttcagcgccagcaaagcccaaagcc
aaggctgttgaagcgaagcctgcgcgcaagcccgcacccaaaaaggcgaaagccgttttc
ccggacacgtttgcgccgcaactggcgacactggtcgatgcgccgcctgcgggcgactgg
ctgtacgagatcaagtttgacggctatcgcatgctgacgcgtatccagaatgacgaggtg
cgtctgttcacccgtaacggcaacgactggactgaccagttgcccgagctgaccaaggcg
ctcaagggcctgaagttgcaagacagttggttcgacggcgaagtggtggtgctcgacgag
caagggctgccggattttcaggggttgcagaatgcctttgatgaggggcacagcaaaaat
attttctattacctgttcgacatgccgtttctgagcggcgaagacctgcgcgaagtgcct
cttgagcagcgtcgcgacgctttgaaacaagtgctcggcagccagcgcagccgcttgctg
cgctattcggatgcgtttcaggccgggcatcaggacatcgtggccagtgctgcggcgatg
ggcctggagggcgtaatcggcaagcgcgctggcagcgcgtacgttggcaagcgcaatgcc
gactggatcaagctcaaatgccggttgcgccaggaattcgtgatcgtcggttataccgcg
ccacaaggcagccgctcggccttcggcgcgctgttgttggcggtcaatgacgatgctcag
gggctggtgtatgccggacgggtcggcaccgggtttaccgaggcgacgctcaaacacgtg
cacaagcaactgaaaccgctgcaccgcgaggaatcgcccttggcgaaaaaactgacctcg
gcgcaggcgcgcggcgtgcagtgggtcgagccgacgctggtctgcgaagctgagtttgcg
cagtggactcgcgagggcatcgtgcgtcaggcagcgtttttcggcctgcgcggtgacaag
ccagctggcgatgtggtgcgtgaagacgctcagccagccgaggctgcgtcagtcactcct
gagccctccaggcagcccggcaagaaaactgcccgaggcaaggttgatgtggcgggcact
ggcatcagtcatccgcagcgggtgatcgacagcactacaggcacgaagaaaatcgagctt
gcgcagttttacgagtctatcgccgactggattctgccgtacctgaacaagcggccagtg
gcattgctgcgctgcccggaaggcatcgacggcgagcagttttttcagaaacacgccgag
caccttgccataccgcatatcaggcagctggatcgggcgctggaccccggccacgccgcg
ctgatggagatcgactctgtgcaggcgctggtgggcgcggcgcagatgggcgccatcgag
ttgcacacctggggcgcgacccgcgacaggatcgaaacaccggatcattttgtgctggac
cttgacccagacccggcgctgccctggcgcagcatgatcgaggccacgcaaatggttctc
gccgtactggaggagctggggcttgaggcttttctcaagaccagtggcggcaaaggcatg
cacattattgtgccgctggcgcgacaggccgagtgggacaccgtgaaagccttcgccaag
gccatcgccgagttcatcagccgtcagttgccggaacgcttcacagccacaatggggccg
aaaaaccgggtcggcaagattttcatcgattacctgcgcaacagtcgtggcggcagcaca
gtgaccgcctattcggtacgcgcccggccgggtttgccggtctcggtgccgattgcgctg
catgagctgaccggtctgacgtcgtcggcgcaatgggacatcaccaaccttgagcaacgc
ttgagccagctcaagagtgacccgtgggccggttacagcaaccggcgcaaaatcacgcaa
aagatgtggaaacagctgggggctaaacagccttga

DBGET integrated database retrieval system