KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4135Help
Entry
PSPTO_4135        CDS       T00118                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst03030  DNA replication
pst03410  Base excision repair
pst03420  Nucleotide excision repair
pst03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pst00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PSPTO_4135
   03410 Base excision repair
    PSPTO_4135
   03420 Nucleotide excision repair
    PSPTO_4135
   03430 Mismatch repair
    PSPTO_4135
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pst03032]
    PSPTO_4135
   03400 DNA repair and recombination proteins [BR:pst03400]
    PSPTO_4135
Enzymes [BR:pst01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PSPTO_4135
    6.5.1.6  DNA ligase (ATP or NAD+)
     PSPTO_4135
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PSPTO_4135
DNA replication proteins [BR:pst03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PSPTO_4135
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PSPTO_4135
DNA repair and recombination proteins [BR:pst03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PSPTO_4135
   NER (nucleotide excision repair)
    Other NER factors
     PSPTO_4135
   MMR (mismatch exicision repair)
    Other MMR factors
     PSPTO_4135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 1185815
NCBI-ProteinID: NP_793896
UniProt: Q87XP1
LinkDB All DBs
Position
4661176..4662891
Genome map
AA seq 571 aa AA seqDB search
MKAFAELYAQLDATTSSNAKLAAMRDYFEKAAAEDAAWAVYFLSGGRPRQLVPTRVLREQ
AMTLASLPEWLFEESYQAVGDLAETLSLLLPQADHSNDEGLATWMEDKLLPLRGLPPEEL
AARLPMFWSQLDRSSLMVCIKLITGSFRVGVSKLLVTRALAALADIDSKRVAQRLVGYTD
LSHRPSAERYLKLIAPESEDEHAQRGGQPYPFFLAHSLQQPADQFETLLGPAENWQVEWK
WDGIRAQLVKRDGRLWIWSRGEELVTDRFPELHSLAQCLPDGTVIDGEIVVWKAPDINPD
ISHDSDAAFALDNDAPNAAPSVQPFALLQQRIGRKTLGKKILTDIPVVVLAYDLLEWQGA
DWRSRPQHERRTQLETLIDSCQSEVLMPSPVLTGKDWLDLATQREASRSLGVEGMMLKAR
DSLYGVGRTKDMGVWWKWKIDPFSVDAVLIYAQRGHGRRASLYSDYTFAVWDGPPEASER
TLVPFAKAYSGLTDEEMRKVDAIVRKTTVEKFGPVSSVTPTLVFELGFEGIALSKRHKSG
IAVRFPRMLRWRQDKPVAEADSLTTLQDLLN
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgccgaactctatgcacagctggacgccaccacgtcgagcaacgccaaa
ctcgccgccatgcgcgactatttcgaaaaagcggcggcagaggacgcagcctgggccgtg
tacttcctgtccggtggacgccccaggcaactggtgccgacccgcgtgctgcgcgagcaa
gccatgacactggcgagcctgcctgaatggttgttcgaagaaagctatcaggccgtcggc
gacctggcggaaaccctgtcattgctgctgccgcaggccgaccacagcaacgacgaaggc
ctggccacgtggatggaagacaagctgctgccattgcgcggcctgccgcccgaagagctg
gccgcgcgcttgcccatgttctggtcgcaactggaccgcagcagcttgatggtttgcatc
aagctgatcaccggcagctttcgcgtcggcgtatcgaaattgctggtcacccgcgcactg
gcagcgctggctgacatcgacagcaagcgcgttgcgcaaaggctggtcggctacacagac
ctgtcgcatcggcccagcgccgagcgctacctcaagctgatcgcgcctgaatcggaagat
gaacacgcgcaacgtggcggtcagccctatccgttctttcttgcgcactccttgcagcag
cctgccgaccagttcgagacgttgctggggccggccgagaactggcaggtggaatggaaa
tgggacggcatccgcgcacaactggtcaaacgtgacggcaggctgtggatctggtcacgg
ggcgaagagctggtcaccgaccgcttcccggaactgcacagcctggcgcaatgcctgccg
gacggcacggtgatcgacggcgaaatcgtggtctggaaagcgcctgacattaacccggac
atcagccacgacagcgatgcagcgttcgcgctggataatgacgccccgaacgctgcgccc
tcagtccagcccttcgccctgctgcaacaacgcatcggccgcaagacactgggcaagaag
atcctcactgacattccggtcgtggtgctggcctacgacctgctggaatggcaaggcgct
gactggcgcagccgcccgcaacacgaacgccgcacgcaactggaaaccttgatcgatagc
tgtcagagcgaggtgctgatgccctcgccggtgctcaccggcaaagactggctcgacctc
gccacccagcgcgaagcatcccgcagcctgggggtcgagggcatgatgctcaaggcccgc
gactcgctgtacggggtcggtcgcaccaaagacatgggcgtctggtggaagtggaaaatc
gacccgttcagcgtcgatgccgtgctgatctatgcgcaacgcggtcatgggcgacgcgcc
agtctgtacagcgattacacgtttgccgtgtgggacggcccgcccgaagcaagcgaacgc
acgctggtgccgttcgccaaagcctactcagggctgaccgacgaagaaatgcgcaaagtg
gacgcaattgtgcgcaagaccaccgtagagaagttcggcccggtgagcagtgtgacgccc
acattggtgttcgagctgggtttcgagggcatcgccttgtccaagcgtcacaagagcggc
atcgccgtacgcttcccgcgcatgctgcgttggcgacaggataaaccggtcgccgaggcc
gatagcctgacgacactgcaggacctgctgaactga

DBGET integrated database retrieval system