KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4363Help
Entry
PSPTO_4363        CDS       T00118                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSPTO_4363 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1186044
NCBI-ProteinID: NP_794118
UniProt: Q87X27
LinkDB All DBs
Position
4925003..4925584
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS
SGGIFNNAAQVWNHTFYWNCLAPNAGGEPTGALAEAINTAFGSFDKFKEEFSKTSIGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKQYAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccaccactgccctacgccaaagacgctctggtgccgcacatttct
gcggagactctggaatatcaccacgacaagcaccacaacacctacgtcgtgaacctgaac
aacctggtgcccggcaccgagttcgaaggcaagaccctggaagagatcatcaagacttct
tcgggcggtatcttcaacaacgccgctcaggtctggaaccacacgttctactggaactgc
ctggcgcctaacgctggcggcgagcctaccggcgctctggccgaggcgatcaacactgca
ttcggttccttcgacaagttcaaggaagagttcagcaagacctccatcggcaccttcggc
tccggctggggctggctggtgaagaaagccgacggctccctggcactggccagcaccatt
ggtgccggcaacccgctgaccagcggcgacacgccgttgctgacctgcgatgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtagaagcgttctggaac
ctggtgaactgggacttcgtggccaagcaatacgcggcctga

DBGET integrated database retrieval system