KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4406Help
Entry
PSPTO_4406        CDS       T00118                                 

Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00473  D-Alanine metabolism
pst00550  Peptidoglycan biosynthesis
pst01100  Metabolic pathways
pst01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSPTO_4406
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSPTO_4406
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PSPTO_4406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pst01011]
    PSPTO_4406
Enzymes [BR:pst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PSPTO_4406
Peptidoglycan biosynthesis and degradation proteins [BR:pst01011]
 Precursor biosynthesis
  Amino acid ligase
   PSPTO_4406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter TTL ATPgrasp_YheCD FOG_N ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 1186087
NCBI-ProteinID: NP_794160
UniProt: Q87WY7
LinkDB All DBs
Position
complement(4972741..4973700)
Genome map
AA seq 319 aa AA seqDB search
MTAVARSSLRSTLEPKSFGRVAVLFGGKSAEREVSLNSGNAVLKALLDAGVDAFGIDVGD
DFLQRLVSEKIDRAFIVLHGRGGEDGTMQGLLECLEIPYTGSGVLASALAMDKLRTKQVW
QSLGPATPLHAVLENENDCICAATELGFPLIVKPAHEGSSIGMAKVNSVDELIAAWKAAS
TYDSQVLVEQWIQGPEFTVASLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLDD
AQEQQLKQLAARACDAIGIAGWARTDVMQDAEGKFWLLEVNTVPGMTDHSLVPMAARAAG
LNFQQLVLAILADSVQARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgttgcccggtcttccctgcgctcgacacttgagccgaaaagcttcggccgt
gtcgccgtgctcttcggtggcaagagtgccgagcgggaagtctccctgaactcggggaat
gcagtgctcaaggcgctgctcgacgctggcgtggatgcgttcggcatcgatgtgggcgac
gacttcctgcagcgactggtcagcgaaaaaatcgaccgtgcgtttattgtcctgcacggc
cgcggcggcgaagacggcaccatgcaagggctgctggaatgtctggaaatcccttacacc
ggcagcggtgtactggcttcggcactggcaatggacaagttgcgcaccaagcaggtctgg
cagagccttggccctgcaacgccgctgcacgccgttctggaaaacgagaacgattgtatt
tgcgcggccacggaactgggcttccctttgatcgtcaaaccggcccatgaaggttcaagt
atcggtatggcgaaggtgaacagcgtcgatgaattgatcgccgcctggaaagctgccagt
acctacgattcgcaagtattagtcgaacagtggattcagggtcctgagtttactgtggcg
tctctgcgtggccaggtgttgcctcccattggcctgggcactcctcacagtttttatgat
tacgacgccaagtacctggcctccgatactcagtaccggatcccgtgtgggcttgacgat
gcacaggaacagcaactcaaacaacttgcagcacgcgcgtgcgacgccatcggcattgca
gggtgggcgcgcacggatgtgatgcaggacgcagagggcaagttctggctgttggaagtc
aataccgtgcccggcatgaccgatcacagtctggtgccgatggcagcacgcgctgccggt
ctgaactttcaacaactggtgttggcgatactagccgacagcgttcaggcgagaggttaa

DBGET integrated database retrieval system