KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4938Help
Entry
PSPTO_4938        CDS       T00118                                 

Definition
(RefSeq) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00340  Histidine metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PSPTO_4938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His Rbsn
Motif
Other DBs
NCBI-GeneID: 1186623
NCBI-ProteinID: NP_794671
UniProt: Q87VJ8
LinkDB All DBs
Position
complement(5596856..5598043)
Genome map
AA seq 395 aa AA seqDB search
MATVDRWLLPDGIEEVLPPEAARIEVARRQVLDLFQSWGYEFVVTPHIEYLESLLTGAGS
DLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLKREGPSRLCYAGSVLHAQPRALSS
SRSPIQLGAELYGDASPSSDVEVISLMLAMLQLADVPDVHMDLGHVGIYRGLARAAGLSG
EVEQQLFDALQRKAIDEVVALTANLPPELASMLRALVDLCGGREVLDAARDRLAGAPAPV
LEALDDLLAIADRLAARFPQLPLYFDLGELRGYHYHTGVVFAVFVPGVGQSIAQGGRYDD
IGADFGRARPATGFSTDLKTLVTLGQAEIVLPSGGIWMPDSTDAALWQQVCQLRSEGQRV
VQALPGQQVSAAREADCDRQLIQHGEHWQVMPLAS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggttgaccgctggctgctaccagatggcatcgaagaagtactgccaccggaa
gcggcgcgcattgaagtagcgcgtcgtcaggtgttggatctgtttcagagctggggctat
gagtttgtcgtcaccccgcatatcgagtatctggagtccttgctgacaggggcgggttcg
gatctggatctgcgcaccttcaaggttatcgatccgcaatcgggccggcagatgggcttt
cgcgccgacatcacgccacaggttgcacgcatcgatgcccacacgcttaaacgtgaaggc
ccgagtcgtctgtgctatgcgggcagcgtactgcacgctcagccgcgcgcgctgtcttcg
tcgcgcagcccgattcagctgggtgccgagttgtacggcgacgcaagcccgagcagtgat
gtcgaggtcatcagtctgatgctggccatgctgcaactggccgatgtgccagatgtgcac
atggacctcgggcatgtcggcatctaccgtggtctggcgcgtgccgccggcctgtcgggc
gaagtcgagcagcagttgttcgatgcattgcaacgcaaggccatcgacgaagtggttgcc
ctgacggccaatctgccgccagagctggcttcgatgctgcgtgcactggttgatctgtgc
ggtggtcgcgaggtgctggatgcggcccgtgaccgtctggctggcgcacctgcgccggtg
ctggaagcgctggatgacctgctggccatcgccgatcgtctggcggcgcgcttcccgcaa
ctgccgttgtatttcgatctcggcgagctgcgtggctaccactaccataccggtgtggta
ttcgccgtgttcgtgccgggtgtggggcagtcgattgcccagggcggtcgttacgatgac
atcggtgccgatttcggtcgtgcccgcccggcgaccggcttttccactgacctgaaaacc
ctggtcacccttgggcaggcagaaatcgtattaccgtccggtggcatctggatgccggac
agcacggatgcggcactctggcagcaggtttgccagttgcgcagcgaaggtcagcgtgtg
gttcaggccttgcctgggcagcaggtgagtgcggcgcgtgaagccgactgtgaccggcaa
ttgattcagcatggcgagcactggcaggtaatgccgctggcttcttga

DBGET integrated database retrieval system