KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5020Help
Entry
PSPTO_5020        CDS       T00118                                 

Definition
(RefSeq) acyl-CoA dehydrogenase family protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00071  Fatty acid degradation
pst00280  Valine, leucine and isoleucine degradation
pst00410  beta-Alanine metabolism
pst00640  Propanoate metabolism
pst00650  Butanoate metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01200  Carbon metabolism
pst01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPTO_5020
   00650 Butanoate metabolism
    PSPTO_5020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSPTO_5020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPTO_5020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPTO_5020
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     PSPTO_5020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N AcylCoA_DH_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 1186705
NCBI-ProteinID: NP_794753
UniProt: Q87VB9
LinkDB All DBs
Position
5709754..5711556
Genome map
AA seq 600 aa AA seqDB search
MSESLLSSRNLAFELYEVLDAEGLTGRERFAEHSRETFDAALGTARVIAEKYFAPHNRKA
DENEPRYEHGEAILIPEVKPAVDAFIAAGFLNASRDFHAGGMQLPTLLSQACFAHFQAAN
VGTTSYPFLTMGAANLIESFGSDEHKQRFLQPMIEGRFFGTMALTEPHAGSSLSDIRTRA
ELADDGTYRLRGNKIFISGGDHSLSENIVHLVLAKLPDAPGGVKGISLFIVPKFLVNDDG
SLGKRNDVLLAGLFHKMGWKGTTSTALNFGDNGECVGYLVGKPHHGLSYMFQMMNEARIG
VGLGAVMLGYSGYLYALDYARDRPQGRLPDSKSPESAPVPIIQHADVRRMLLTQKAYVEG
AFDLCLYASRLFDDTQTGETEDVRKHAHELLDLLTPVVKSWPSEFCLKANELAIQVLGGH
GYTREYPVEQYYRDNRLNPIHEGTHGIQSLDLLGRKLAQNGGTALKQLLRLIANTCERAQ
AHESLVKLRQPLEQLVARLQAVTLGLLGDLAQGRITSTLANSALYLKAFGHTVIGWRWLE
QAIRAEEGLGKGNSADSDFYQGKLKAARYFLTWEVPGCHHELAILENRDDTCLAMRDDWF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtcgctgctcagttcccgaaacctggctttcgagctgtatgaagtgctggac
gccgaaggtctgacgggtcgcgagcgctttgccgagcactcgcgggaaacctttgacgca
gccctggggacagcgcgcgtcatcgcggaaaagtactttgcaccgcacaaccgcaaggcc
gacgaaaacgaaccgcgctatgaacatggcgaggcgattctgatcccggaggtcaagcct
gcggtggatgcgtttattgcggcgggctttctcaacgcatcgcgtgatttccacgcaggt
ggcatgcaattgcctaccctgctgtcgcaagcctgctttgcccactttcaggccgccaac
gtcgggaccacgtcctatccgtttctgaccatgggcgccgccaacctgatcgaaagtttt
ggcagtgacgagcacaaacaacgttttctgcaaccgatgatcgaggggcgctttttcggc
acgatggcgctgaccgagccccatgcgggttcatcattgtcagacatccgcacacgcgcc
gaactggcagatgacggtacgtatcggctgcgtggcaacaagatattcatttccgggggc
gatcattcgctgtcggaaaatatcgtgcacctggtgctggcgaaactgccggatgcgcca
ggtggcgtcaaaggcatctcactgttcatcgtgcccaagtttctggtcaacgacgacggc
agcctaggcaagcgcaatgatgtgctgcttgccgggctgtttcacaagatgggctggaaa
ggcactacctctacagcgctgaatttcggcgataacggtgaatgtgtcggctatctggtt
ggcaagccgcatcacggtttgagttacatgttccagatgatgaacgaagcgcgtatcggc
gttggcctgggcgctgtcatgttgggctactccggttatctgtatgcgctggattacgcc
cgggatcgacctcagggtcgcctgcccgacagcaaaagccccgagagcgcgcccgtgccg
atcattcagcacgctgacgtgcggcgcatgttgctgacccagaaggcttacgtagagggc
gcattcgacctgtgcctgtatgcctcacggctgttcgacgacacccagaccggggaaacc
gaagacgtgcgcaagcacgcccatgagctgctggacttgctgacccccgtcgtcaaatcc
tggccttcggagttctgcctgaaggccaatgaactggcgattcaggtgctcggcggtcat
ggttacacccgcgagtatcccgttgagcagtactaccgcgacaaccggctcaatccgatt
catgaaggcactcacggcatccagtcactggacctgctcgggcgcaagctcgcgcagaac
ggtggcaccgccctcaagcaactgctgcgcctgatcgccaacacctgcgagcgcgcgcag
gctcacgagtcactcgttaaactgcgccagcctctggaacaattggttgctcgcttgcag
gctgtcactctggggctgctgggcgatctggcgcaaggcaggatcaccagcacactggcc
aactcggcgctgtacctcaaggcattcggtcacacggtaatcggctggcgctggctggaa
caggcaatccgcgccgaggaaggcctgggcaaaggtaattcggcggacagtgatttttac
cagggcaagttgaaagcagcccggtatttcctgacgtgggaagtaccgggctgccatcat
gaactggcgattctggaaaaccgcgatgacacctgtctggcaatgcgcgatgactggttc
tga

DBGET integrated database retrieval system