KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5490Help
Entry
PSPTO_5490        CDS       T00118                                 

Definition
(RefSeq) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00010  Glycolysis / Gluconeogenesis
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_5490
Enzymes [BR:pst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSPTO_5490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1187182
NCBI-ProteinID: NP_795214
UniProt: Q87U25
LinkDB All DBs
Position
6256840..6257751
Genome map
AA seq 303 aa AA seqDB search
MPTSPVEPLVESVQYDELNCWRIRHGEAELLVAQQGAHILSYQVAGQPPLVWLNEEAAFK
KGKAIRAGMPICWPWFGNLERNPQSVQAMRDSSEPAKAHGEVRALDWQLLGIGADGDALL
VEFVLPEAEGHLPGWPHNVALKLSIRLDHALNVSLVSYNCGAEPVTFSQALHTYFAVSDV
RQVSIEGLDGLRYIETLANWEEREQTGDLTFTGETDRIYQDTPGVLSIIDPEWQRRIHIR
STGSKSAILWNPWIEKTGTFTDMAADGWQRMVCVETANVLDDVVTLAPDQMHVLGVSIWG
ESL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatccccggttgaacccctcgtcgaatccgtccagtacgatgaactgaactgt
tggcgcattcgccacggcgaagcagagctgctggtcgcccagcaaggcgcacacatcctc
agctatcaggtggccggacaaccgccactggtgtggctgaacgaagaagcggcgttcaag
aaaggcaaagcgatccgtgcgggcatgcccatctgctggccgtggttcggcaatctggag
cgcaaccctcagagcgtgcaggccatgcgcgacagcagcgaacccgccaaggcccacgga
gaagtccgcgcactggactggcaactgctcggtattggcgcagatggcgatgcactgctg
gtagagtttgtcctccccgaagctgaaggccacttgccaggctggccgcacaacgtcgcc
ctgaaactgagcattcgcctggaccacgctctgaacgtcagtctggtcagctataactgc
ggcgcagaaccggtcaccttcagtcaggcgttgcacacctatttcgccgtcagcgatgtt
cgtcaggtcagcatcgaaggactcgacggcctgcgctacatcgaaaccctggcaaactgg
gaagaacgcgaacagaccggcgacctgacgttcaccggcgaaaccgaccgcatctaccag
gacacaccaggcgtgctcagcatcattgaccctgagtggcagcgacgcatccacatccgc
agcaccggctcgaaatcagccatcctgtggaacccgtggatcgagaaaaccggcacattc
accgacatggcagccgacggctggcagcgcatggtctgcgtcgaaaccgccaacgtgctg
gacgacgtggtcacgctggcgcctgaccagatgcatgtgctgggggtgagtatctggggt
gagagtctctga

DBGET integrated database retrieval system