KEGG   Providencia stuartii BE2467: BGK56_02735Help
Entry
BGK56_02735       CDS       T04734                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00473  D-Alanine metabolism
psta00550  Peptidoglycan biosynthesis
psta01100  Metabolic pathways
psta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BGK56_02735
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BGK56_02735
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BGK56_02735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
    BGK56_02735
Enzymes [BR:psta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BGK56_02735
Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
 Precursor biosynthesis
  Amino acid ligase
   BGK56_02735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: APG49921
UniProt: A0A379GMW4
LinkDB All DBs
Position
590197..591300
Genome map
AA seq 367 aa AA seqDB search
MSKLRVGVIFGGKSTEHEVSLQSAKNIINGLDRDRFDVCLIGINKQGHWHEYDEADFLIH
ANDPARIALSTPKRSIAIIPGKTTQQFISLEDAQPLPQIDVIFPIVHGNLGEDGSLQGLL
RMANLPFVGPGVLGSSACMDKDITKRLLRDAGLHVAPFITLTASDRTEANYEAVVKQLGL
PLFIKPANQGSSVGISKVTNESEFKAALDFAFLFDMKVLIESAVKGREIECAVLGNEQPL
ASPCGEIVLHDSFYAYHTKYIDENGASVVAPADLDVEVSDKIREIALQAYRALNCSGMSR
VDVFLTEDNHVIINEINTLPGFTNISMYPKLWQQGGMTYQALISRLIELGIEKYQQTIAL
KTACDVN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattacgggtaggtgtcatttttggtggtaaatcaacagagcatgaagtgtca
ttgcagtcagcgaagaacatcattaatggtcttgatcgcgatagatttgatgtatgctta
atcggcattaacaaacaggggcattggcatgaatatgatgaagctgattttttaatccat
gcaaatgatcccgctcgtattgcactaagtacgccaaaacgcagtatcgctattatccct
ggtaaaacaacccagcaatttatttcccttgaagatgctcagccactccctcaaattgat
gttattttccccattgtgcacggtaatttgggtgaagacggctctttgcaagggttattg
cgtatggctaatttaccttttgttggcccaggtgttttaggctcttcagcctgtatggat
aaagatatcactaagcgattactacgcgatgcggggctacatgttgcaccttttattacg
ctgacagcgtcggatcgcactgaagccaactatgaagcggttgttaaacaattaggcctc
ccattatttattaaaccggctaaccaaggctcttctgttgggatcagtaaagtgactaat
gagtctgagtttaaggcagcattggatttcgctttcttgttcgatatgaaagtcctgatc
gaaagtgcagtgaaaggccgtgagatagaatgtgcggtattagggaacgaacagccattg
gcaagtccatgtggcgaaattgttctacatgatagcttctacgcttatcacaccaaatat
atcgatgaaaatggtgcgtctgtggtagcaccagcggatttagatgttgaagtgagtgat
aaaatacgggaaattgcattacaggcttatcgtgcactcaattgcagtggtatgtctcgc
gttgatgttttcttgaccgaagataatcacgttattatcaatgaaattaatacactacca
gggtttacgaatatcagtatgtaccctaaattgtggcaacagggcgggatgacatatcaa
gcgttgatcagccgccttattgaactaggcattgaaaaatatcaacaaaccattgcttta
aaaacagcgtgtgatgttaattaa

DBGET integrated database retrieval system