KEGG   Providencia stuartii BE2467: BGK56_03910Help
Entry
BGK56_03910       CDS       T04734                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00473  D-Alanine metabolism
psta01100  Metabolic pathways
psta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BGK56_03910
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BGK56_03910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
    BGK56_03910
Enzymes [BR:psta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BGK56_03910
Peptidoglycan biosynthesis and degradation proteins [BR:psta01011]
 Precursor biosynthesis
  Racemase
   BGK56_03910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a GAD
Motif
Other DBs
NCBI-ProteinID: APG50139
LinkDB All DBs
Position
complement(845379..846602)
Genome map
AA seq 407 aa AA seqDB search
MSFRLRYLALLPLLVATACQQPANTNTKAIPDAQVQPIIVNNSWIEISRSALDFNIKKVQ
ALLGDKSSLCAVLKGDAYGHDLTLVTPLMIENNVQCIGLTNNQEFKQVRELGFKGRLMRV
RNATEQEMAQATAYDVEELIGNLDMAQRLNDIGKKQNKVIPIHLALNSAGMSRNGLEVSH
AQGLNDAKMIAQLPQLKVVGIMSHYPEEDEAQIRKDLAKFKKQSQQVLDVTGLKREDVIL
HVANTYATITVPESWLDMVRVGGIFYGDTVATKDYKRVMTLKSNIASVNHYPKGNTVGYD
RTYTLKRDSVLANIPVGYADGYRRVFSNAGHALINGQMVPVLGKTSMNTVMVDVTDLKQV
QPGDEVVFFGKQGNGEITAEEVEDISGALFTEMSILWGATNKRILVD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcggttgagatatcttgctttacttcctctattggtcgcaacagcttgccag
caacctgcaaacaccaacaccaaagcgatccctgacgcacaagtccaacccattattgtg
aataattcttggatagaaatttctcgtagtgcactcgatttcaatattaaaaaagtgcag
gcgttgctgggggataagtcatcgctttgtgctgtattgaaaggggatgcgtatggtcat
gatttgacgctggtaacgcctctgatgattgaaaataatgtgcaatgtattggcttaaca
aataatcaagaatttaaacaagtcagagagttaggtttcaaaggccgtttgatgagagtg
cgtaatgccactgaacaagaaatggcacaagcaacagcctatgacgttgaagagcttatc
ggtaatctcgatatggcacagcgtttaaatgatattggtaaaaagcaaaataaagtaata
ccaatccatttagcgttgaattcagcgggaatgtcacgtaatgggctagaagtgagtcat
gcgcaaggcctcaatgacgcaaaaatgattgctcaattacctcagctaaaagttgttggc
atcatgtcgcattatcctgaagaagatgaggctcaaatccgcaaagatttagcgaagttt
aaaaagcagtcacaacaagtccttgatgtaactggattgaaacgtgaagatgtcattttg
catgtagcgaatacctatgcaaccatcactgtacctgagtcatggcttgatatggtgcgt
gttggcggtattttctatggtgacacggtagcaacgaaagactataagcgtgtcatgaca
ttaaaatcgaatattgcctcggtgaatcattaccctaaaggaaacacggtcggttatgac
agaacctatacgctaaaacgtgactctgtattggctaatattcctgtcggttatgctgac
ggctaccgccgagtattcagtaatgcggggcacgcattaattaatgggcagatggtgcct
gtattaggaaaaacatcaatgaataccgtgatggtcgatgtgactgacttaaagcaagtc
caacccggagatgaagttgttttctttggtaaacaaggtaatggtgaaatcactgccgaa
gaggttgaagatatcagtggagcattatttactgaaatgtcaattctttggggagcgacc
aacaaacgtattcttgtcgattaa

DBGET integrated database retrieval system