KEGG   Providencia stuartii BE2467: BGK56_04820
Entry
BGK56_04820       CDS       T04734                                 

Definition
(GenBank) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
psta  Providencia stuartii BE2467
Pathway
psta01503  Cationic antimicrobial peptide (CAMP) resistance
psta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BGK56_04820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BGK56_04820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psta01001]
    BGK56_04820
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psta02022]
    BGK56_04820
   01504 Antimicrobial resistance genes [BR:psta01504]
    BGK56_04820
Enzymes [BR:psta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BGK56_04820
Protein kinases [BR:psta01001]
 Histidine kinases
  OmpR family
   BGK56_04820
Two-component system [BR:psta02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   BGK56_04820
Antimicrobial resistance genes [BR:psta01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    BGK56_04820
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HATPase_c_2 HisKA SEO_N
Other DBs
NCBI-ProteinID: APG50310
LinkDB
Position
1007368..1008834
AA seq 488 aa
MANMRLKKFKFKPLSLRARFLCATSAVILALTLSYGIVAILGYLISFDKTTYTLLRSQSN
LIYSLVQWQNNKIDIRVPPNFTLNNPTLIIIYNENGQVLWRQREMPNVENLIRRDWLKKE
GLYEIDTDIGETRLLLQNNPEFNSKLDDMNHNDEPLTHSVSVNQYGATENLPPLTIVVVD
TLPQDLQKTGLVWEWFGYVLLANLILVIPLLWLAAYWSLRPIKSLVSQISSLEKGEREML
DENPPYELRGLVRNLNNLLTNERKRYSKYRTTLSDLTHSLKTPLAVLQSTLRSLRTGKQM
TIEQAEPVMLEQIGRISQQVGYYLHRASAQGDNNLMLREISSVPSLLDSLASALHKVYQN
KGVSITVDISPEVTWLGQPNDFMEVMGNIMENACKYCLEFVEVTARVGDDHLVITVDDDG
PGVPESQRNLIFARGQRVDTLRPGQGLGLSIAVEIIDQYDGDITISDSPLGGARVEVTFR
RQEVNQDN
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggctaatatgcggctaaagaaatttaaatttaagcctttatccctgagggcacgcttt
ttgtgtgcgacctcagcggtgatcctcgccctaacgctctcctatggtattgtcgccata
ttaggctatttaattagttttgataaaacgacctataccttgttacgtagccaaagcaat
cttatttatagtttagtgcagtggcaaaataacaaaattgatattcgcgtaccgcctaac
ttcaccttaaataatccaacgttaatcataatatacaatgaaaacgggcaggttctatgg
cgccaacgggaaatgcctaacgtcgaaaacctcattcgccgtgattggttaaaaaaagaa
gggttgtatgaaattgacactgatatcggtgaaactcgcctgttgttacaaaacaaccct
gaatttaacagtaaacttgatgatatgaaccataatgacgagccgctaacccactcagtg
tccgtcaatcaatatggtgcgacagaaaatctcccaccgctgactattgtggtcgttgat
acattgcctcaggacttacaaaaaacggggttagtctgggaatggtttggctatgtactg
cttgctaatcttattttagtgatccctctactttggctcgccgcttattggagcttgcgc
cccattaaatcgctcgtttcacaaattagtagcctagaaaaaggtgaacgcgagatgttg
gatgaaaatccaccttatgagttgcgtggcttggttcgaaacttaaataatttgctgact
aacgagcgtaagcgttatagcaaatatcgcaccacgctttctgatttaacccatagccta
aaaacccctcttgccgttttacagtccactttgcgctcactaagaacaggtaaacagatg
acgattgagcaagcagagcctgtgatgcttgagcaaattggtcgtatttctcaacaagtg
ggttattacttgcatcgggcttctgctcaaggtgacaataaccttatgttgcgcgagata
tcctcagttccctctttgctcgatagtcttgctagcgccttacataaggtttatcaaaat
aaaggtgtctcgattaccgttgatatttcgcctgaagtgacttggctaggccaaccgaat
gactttatggaagtgatgggcaacataatggaaaacgcctgtaagtactgccttgagttc
gtcgaagtgaccgcccgtgttggggatgaccatttggtgatcactgtcgatgatgatggc
cccggtgtacccgaaagccaacgtaaccttatttttgcgcgggggcaacgtgttgatacc
ttaaggcccggtcaaggccttggcttatctatcgccgttgaaattattgaccaatatgat
ggcgatattacgatcagtgacagcccgctcggtggtgcacgagtggaagtaacttttcgt
cggcaagaagtgaatcaagataattaa

DBGET integrated database retrieval system